Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6133.t1
Gene name
Locationscaffold_16:54683..57595
Strand+
Gene length (bp)2912
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-09 6 67
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.9E-17 314 384
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.3E-10 497 557
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.9E-11 610 684
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.4E-15 715 783
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-01 725 795

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 61.58 37.77 85.40
5d_25C Five days - 25 degrees Celsius 63.15 38.78 87.51
7d_25C Seven days - 25 degrees Celsius 73.04 44.57 101.51
10d_25C Ten days - 25 degrees Celsius 57.21 35.12 79.30
7d_15C Seven days - 15 degrees Celsius 80.95 48.66 113.25
7d_30C Seven days - 30 degrees Celsius 60.36 37.03 83.68

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.940056 no
3d_25C 7d_25C 0.494739 no
3d_25C 7d_15C 0.222685 no
3d_25C 7d_30C 0.951700 no
3d_25C 10d_25C 0.801478 no
5d_25C 7d_25C 0.575705 no
5d_25C 7d_15C 0.284873 no
5d_25C 7d_30C 0.884358 no
5d_25C 10d_25C 0.718824 no
7d_25C 7d_15C 0.720550 no
7d_25C 7d_30C 0.440632 no
7d_25C 10d_25C 0.291041 no
7d_15C 7d_30C 0.193110 no
7d_15C 10d_25C 0.108148 no
7d_30C 10d_25C 0.864888 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6133.t1
MESTRVFVGGLPPTCSNDQLKKHFATRFQVTDAHVLPKRRMGFVGFKSHEAALQAVKHFNKTYMKMSKIAVDIAR
PIDSNDAEDAHPTRRRDATNDNDASLDNNLKRKRDGENKSQDPKLQEYLSLMGSSSKTRTWANDDDMIKPSVDTV
PVINQPAQEEEQIQDLPSHPKKAKTEKPSTVATPEQPEPMVIDKIEEQEAQETPEQDNSAEPEEETRPVSDADWL
RSKTSRLLGLLDEEEQDEFDQHKAAAPTTAPIKAHSPPSSSGDESPQRDEESRTAAIEKIAPNTTDVDSITEATP
EDPNIDLIRKSARLFLRNLAYDTTESDLQPIFERFGKIEEIHVAFDTRSTTSKGFAYVQYSHADAAIEAYQTLDG
KHFQGRLLHILPASAKKTYKIDEYELSKLPLKKQREIKRKQNASGSSFSWNSLYMNADAVMSSVASRLGVSKSEL
LDPTSSEAAVKQAHAETHVIQETKAYFASNGVNIDAFKQRERGNTAILVKNFSYGVTSAELRSLFDPYGKIIRLL
MPPSGTIAIVQFAQPDEAQKAFKGMAYRKIGDSILFLEKAPKNLFDGSAAPPTLAPETRGKDQGFSTADTFAADE
PDDSVATTTLFVKNLNFSTTNEKFLEVFRSLDGFITGRIKTKPDPKRPGQTLSMGFGFADFKTKGQAQAALSAMN
GYKLDQHELLIRASHKGKDAAEERRREDTAKKVAARRTKIIIKNLPFQATKKDIRSLFGAYGQLRSVRVPQKFDH
TARGFGFADFVSAREAENAMDALKNTHLLGRRLVLEFVNEEAVDPEEELARLEKKVGEQMDRVKLQQLTTGAGRK
KFTVGGQEEE*
Coding >Pro_DTO377G3_2|g6133.t1
ATGGAGAGCACTAGAGTGTTCGTGGGTGGTCTCCCACCGACATGCTCTAATGATCAGCTAAAGAAACATTTTGCA
ACTCGCTTTCAAGTCACCGATGCTCATGTCCTACCTAAACGTAGGATGGGGTTCGTCGGCTTCAAAAGCCATGAA
GCAGCCCTGCAAGCTGTGAAGCACTTCAACAAGACATACATGAAGATGTCGAAGATCGCTGTAGACATCGCTCGT
CCGATTGACTCAAATGACGCTGAGGATGCCCACCCCACACGACGACGTGATGCCACGAATGATAATGATGCATCG
TTGGATAACAACCTCAAGCGCAAGAGGGACGGCGAGAACAAATCACAGGACCCTAAGCTACAAGAGTACCTCTCT
CTGATGGGATCATCATCGAAGACTCGGACATGGGCCAACGATGATGATATGATCAAGCCGTCAGTGGACACGGTT
CCCGTTATTAACCAACCCGCGCAGGAAGAAGAGCAGATTCAGGACCTGCCTTCACACCCAAAAAAGGCAAAGACA
GAAAAACCTTCCACGGTAGCAACGCCTGAGCAGCCTGAGCCCATGGTAATTGACAAGATTGAAGAACAGGAGGCT
CAAGAAACACCAGAACAGGACAACTCTGCGGAGCCTGAAGAGGAGACTAGACCTGTATCTGATGCAGATTGGCTA
CGGTCAAAGACGAGTCGTTTGTTGGGCCTTCTCGATGAGGAAGAACAAGATGAGTTTGATCAACACAAGGCCGCC
GCACCGACTACTGCGCCGATCAAAGCTCATTCACCACCTTCCTCGTCTGGCGATGAGTCGCCTCAGCGTGACGAA
GAATCGCGCACTGCGGCCATTGAGAAAATTGCGCCCAACACGACTGACGTTGACAGCATCACCGAGGCAACGCCG
GAAGATCCGAATATCGATCTTATTCGGAAATCGGCCCGTTTATTCCTCCGGAATCTTGCCTATGACACCACGGAA
TCTGATCTACAACCGATTTTTGAACGCTTTGGAAAGATTGAGGAGATTCACGTTGCTTTTGACACACGCTCCACA
ACTAGTAAAGGCTTTGCTTATGTGCAATACTCGCATGCTGATGCGGCCATTGAGGCCTACCAGACCCTTGATGGC
AAGCATTTCCAGGGTCGTCTGCTCCACATCTTGCCTGCTTCTGCGAAAAAGACCTACAAGATTGACGAATACGAA
TTGTCAAAGCTTCCTCTGAAGAAGCAGAGGGAGATCAAGCGAAAACAAAACGCCTCTGGATCGTCATTTAGTTGG
AACTCCCTATACATGAATGCCGATGCTGTGATGTCATCAGTGGCCTCAAGGCTCGGAGTCTCCAAATCTGAACTG
CTTGATCCCACTTCTTCAGAAGCCGCCGTCAAGCAAGCACATGCTGAAACGCATGTGATTCAAGAAACTAAAGCC
TACTTTGCTTCGAATGGAGTAAATATTGATGCTTTCAAGCAGCGCGAACGTGGGAACACGGCTATTTTGGTCAAG
AACTTCTCATATGGTGTCACGTCGGCAGAGCTCAGGAGTCTGTTCGATCCATATGGCAAGATTATCCGACTCTTG
ATGCCGCCAAGTGGCACTATTGCTATCGTGCAATTTGCGCAGCCTGACGAGGCCCAGAAGGCTTTCAAGGGCATG
GCATACCGCAAGATAGGTGATTCTATCTTGTTCCTGGAGAAAGCACCGAAGAATTTGTTTGATGGTTCAGCAGCT
CCACCCACACTTGCTCCAGAGACTCGGGGCAAGGATCAAGGTTTCTCAACTGCAGACACATTTGCCGCAGATGAA
CCTGATGACAGCGTAGCAACTACGACACTCTTCGTAAAAAACCTGAATTTCTCGACCACAAATGAGAAGTTCCTG
GAAGTGTTTCGATCTCTGGATGGCTTTATCACTGGTCGCATCAAGACCAAACCTGATCCCAAGCGACCAGGGCAG
ACCCTCAGCATGGGATTCGGCTTTGCGGATTTCAAAACCAAGGGTCAAGCCCAGGCTGCTCTTTCAGCTATGAAC
GGCTACAAGTTGGATCAGCACGAGCTTCTCATCCGCGCATCCCATAAAGGCAAGGATGCCGCCGAGGAGCGGAGG
CGCGAAGATACCGCGAAGAAGGTTGCAGCGCGGAGAACCAAAATCATCATCAAGAACTTGCCGTTCCAGGCCACG
AAGAAGGACATCAGATCTCTCTTCGGGGCATATGGACAACTTCGGTCTGTGCGTGTTCCCCAGAAGTTCGATCAT
ACTGCTCGTGGTTTCGGTTTTGCAGACTTTGTAAGCGCTCGCGAAGCAGAAAATGCCATGGACGCGTTGAAAAAC
ACGCATCTCCTGGGGAGACGATTGGTTTTGGAGTTCGTGAACGAGGAGGCCGTCGATCCCGAGGAGGAGCTCGCG
CGCCTAGAGAAGAAGGTAGGAGAGCAGATGGACAGGGTCAAACTTCAACAGCTTACTACTGGCGCCGGGCGCAAG
AAATTTACTGTAGGAGGGCAGGAGGAAGAGTGA
Transcript >Pro_DTO377G3_2|g6133.t1
ATGGAGAGCACTAGAGTGTTCGTGGGTGGTCTCCCACCGACATGCTCTAATGATCAGCTAAAGAAACATTTTGCA
ACTCGCTTTCAAGTCACCGATGCTCATGTCCTACCTAAACGTAGGATGGGGTTCGTCGGCTTCAAAAGCCATGAA
GCAGCCCTGCAAGCTGTGAAGCACTTCAACAAGACATACATGAAGATGTCGAAGATCGCTGTAGACATCGCTCGT
CCGATTGACTCAAATGACGCTGAGGATGCCCACCCCACACGACGACGTGATGCCACGAATGATAATGATGCATCG
TTGGATAACAACCTCAAGCGCAAGAGGGACGGCGAGAACAAATCACAGGACCCTAAGCTACAAGAGTACCTCTCT
CTGATGGGATCATCATCGAAGACTCGGACATGGGCCAACGATGATGATATGATCAAGCCGTCAGTGGACACGGTT
CCCGTTATTAACCAACCCGCGCAGGAAGAAGAGCAGATTCAGGACCTGCCTTCACACCCAAAAAAGGCAAAGACA
GAAAAACCTTCCACGGTAGCAACGCCTGAGCAGCCTGAGCCCATGGTAATTGACAAGATTGAAGAACAGGAGGCT
CAAGAAACACCAGAACAGGACAACTCTGCGGAGCCTGAAGAGGAGACTAGACCTGTATCTGATGCAGATTGGCTA
CGGTCAAAGACGAGTCGTTTGTTGGGCCTTCTCGATGAGGAAGAACAAGATGAGTTTGATCAACACAAGGCCGCC
GCACCGACTACTGCGCCGATCAAAGCTCATTCACCACCTTCCTCGTCTGGCGATGAGTCGCCTCAGCGTGACGAA
GAATCGCGCACTGCGGCCATTGAGAAAATTGCGCCCAACACGACTGACGTTGACAGCATCACCGAGGCAACGCCG
GAAGATCCGAATATCGATCTTATTCGGAAATCGGCCCGTTTATTCCTCCGGAATCTTGCCTATGACACCACGGAA
TCTGATCTACAACCGATTTTTGAACGCTTTGGAAAGATTGAGGAGATTCACGTTGCTTTTGACACACGCTCCACA
ACTAGTAAAGGCTTTGCTTATGTGCAATACTCGCATGCTGATGCGGCCATTGAGGCCTACCAGACCCTTGATGGC
AAGCATTTCCAGGGTCGTCTGCTCCACATCTTGCCTGCTTCTGCGAAAAAGACCTACAAGATTGACGAATACGAA
TTGTCAAAGCTTCCTCTGAAGAAGCAGAGGGAGATCAAGCGAAAACAAAACGCCTCTGGATCGTCATTTAGTTGG
AACTCCCTATACATGAATGCCGATGCTGTGATGTCATCAGTGGCCTCAAGGCTCGGAGTCTCCAAATCTGAACTG
CTTGATCCCACTTCTTCAGAAGCCGCCGTCAAGCAAGCACATGCTGAAACGCATGTGATTCAAGAAACTAAAGCC
TACTTTGCTTCGAATGGAGTAAATATTGATGCTTTCAAGCAGCGCGAACGTGGGAACACGGCTATTTTGGTCAAG
AACTTCTCATATGGTGTCACGTCGGCAGAGCTCAGGAGTCTGTTCGATCCATATGGCAAGATTATCCGACTCTTG
ATGCCGCCAAGTGGCACTATTGCTATCGTGCAATTTGCGCAGCCTGACGAGGCCCAGAAGGCTTTCAAGGGCATG
GCATACCGCAAGATAGGTGATTCTATCTTGTTCCTGGAGAAAGCACCGAAGAATTTGTTTGATGGTTCAGCAGCT
CCACCCACACTTGCTCCAGAGACTCGGGGCAAGGATCAAGGTTTCTCAACTGCAGACACATTTGCCGCAGATGAA
CCTGATGACAGCGTAGCAACTACGACACTCTTCGTAAAAAACCTGAATTTCTCGACCACAAATGAGAAGTTCCTG
GAAGTGTTTCGATCTCTGGATGGCTTTATCACTGGTCGCATCAAGACCAAACCTGATCCCAAGCGACCAGGGCAG
ACCCTCAGCATGGGATTCGGCTTTGCGGATTTCAAAACCAAGGGTCAAGCCCAGGCTGCTCTTTCAGCTATGAAC
GGCTACAAGTTGGATCAGCACGAGCTTCTCATCCGCGCATCCCATAAAGGCAAGGATGCCGCCGAGGAGCGGAGG
CGCGAAGATACCGCGAAGAAGGTTGCAGCGCGGAGAACCAAAATCATCATCAAGAACTTGCCGTTCCAGGCCACG
AAGAAGGACATCAGATCTCTCTTCGGGGCATATGGACAACTTCGGTCTGTGCGTGTTCCCCAGAAGTTCGATCAT
ACTGCTCGTGGTTTCGGTTTTGCAGACTTTGTAAGCGCTCGCGAAGCAGAAAATGCCATGGACGCGTTGAAAAAC
ACGCATCTCCTGGGGAGACGATTGGTTTTGGAGTTCGTGAACGAGGAGGCCGTCGATCCCGAGGAGGAGCTCGCG
CGCCTAGAGAAGAAGGTAGGAGAGCAGATGGACAGGGTCAAACTTCAACAGCTTACTACTGGCGCCGGGCGCAAG
AAATTTACTGTAGGAGGGCAGGAGGAAGAGTGA
Gene >Pro_DTO377G3_2|g6133.t1
ATGGAGAGCACTAGAGTGTTCGTGGGTGGTCTCCCACCGACATGCTCTAATGATCAGCTAAAGAAACATTTTGCA
ACTCGCTTTCAAGTCACCGATGCTCATGTCCTACCTAAACGTAGGATGGGGTTCGTCGGCTTCAAAAGCCATGAA
GCAGCCCTGCAAGCTGTGAAGCACTTCAACAAGACATACATGAAGATGTCGAAGATCGCTGTAGACATCGCTCGT
CCGGTATGTCGATTCTCAGCTCTTTTTGCTTCAGCCACCCTCCTTTCGCCTGTGCACGCTGACCAATTAAGGTGG
TCTTGAGACTGACCCGTATTATTGCAGATTGACTCAAATGACGCTGAGGATGCCCACCCCACACGACGACGTGAT
GCCACGAATGATAATGATGCATCGTTGGATAACAACCTCAAGCGCAAGAGGGACGGCGAGAACAAATCACAGGAC
CCTAAGCTACAAGAGTACCTCTCTCTGATGGGATCATCATCGAAGACTCGGACATGGGCCAACGATGATGATATG
ATCAAGCCGTCAGTGGACACGGTTCCCGTTATTAACCAACCCGCGCAGGAAGAAGAGCAGATTCAGGACCTGCCT
TCACACCCAAAAAAGGCAAAGACAGAAAAACCTTCCACGGTAGCAACGCCTGAGCAGCCTGAGCCCATGGTAATT
GACAAGATTGAAGAACAGGAGGCTCAAGAAACACCAGAACAGGACAACTCTGCGGAGCCTGAAGAGGAGACTAGA
CCTGTATCTGATGCAGATTGGCTACGGTCAAAGACGAGTCGTTTGTTGGGCCTTCTCGATGAGGAAGAACAAGAT
GAGTTTGATCAACACAAGGCCGCCGCACCGACTACTGCGCCGATCAAAGCTCATTCACCACCTTCCTCGTCTGGC
GATGAGTCGCCTCAGCGTGACGAAGAATCGCGCACTGCGGCCATTGAGAAAATTGCGCCCAACACGACTGACGTT
GACAGCATCACCGAGGCAACGCCGGAAGATCCGAATATCGATCTTATTCGGAAATCGGCCCGTTTATTCCTCCGG
AATCTTGCCTATGACACCACGGAATCTGATCTACAACCGATTTTTGAACGCTTTGGAAAGATTGAGGAGGTTAGT
ACTTACCTTTTTTTGCTTTCTCAACCCTGCCCCGCCTTTCCCCCAGTGCGGCAGACTAGCCTGTTTGTTACGAGT
GCTCGTATGATGATTTTCCCGATAGGGACATCCGATGCAAATTGCAAATGATGTTACCAGGACAAGATATTTTAG
TAGATGCTTCTTGACTATCTGAAAGAGCCAACTCAACCCACTTTTCCACATTTACACATTATATTCAATGACCTT
GAGTACTAATTGAATATAGATTCACGTTGCTTTTGACACACGCTCCACAACTAGTAAAGGCTTTGCTTATGTGCA
ATACTCGCATGCTGATGCGGCCATTGAGGCCTACCAGACCCTTGATGGCAAGCATTTCCAGGGTCGTCTGCTCCA
CATCTTGCCTGCTTCTGCGAAAAAGACCTACAAGATTGACGAATACGAATTGTCAAAGCTTCCTCTGAAGAAGCA
GAGGGAGATCAAGCGAAAACAAAACGCCTCTGGATCGTCATTTAGTTGGAACTCCCTATACATGAATGTGAGTTT
ACCTCTTACCACCACCAATCAAAAGGTTGAGACTAATTTCGCTACAGGCCGATGCTGTGATGTCATCAGTGGCCT
CAAGGCTCGGAGTCTCCAAATCTGAACTGCTTGATCCCACTTCTTCAGAAGCCGCCGTCAAGCAAGCACATGCTG
AAACGCATGTGATTCAAGAAACTAAAGCCTACTTTGCTTCGAATGGAGTAAATATTGATGCTTTCAAGCAGCGCG
AACGTGGGAACACGGCTATTTTGGTCAAGAACTTCTCATATGGTGTCACGTCGGCAGAGCTCAGGAGTCTGTTCG
ATCCATATGGCAAGATTATCCGACTCTTGATGCCGCCAAGTGGCACTATTGCTATCGTGCAATTTGCGCAGCCTG
ACGAGGCCCAGAAGGCTTTCAAGGGCATGGCATACCGCAAGATAGGTGATTCTATCTTGTTCCTGGAGAAAGCAC
CGAAGAATTTGTTTGATGGTTCAGCAGCTCCACCCACACTTGCTCCAGAGACTCGGGGCAAGGATCAAGGTTTCT
CAACTGCAGACACATTTGCCGCAGATGAACCTGATGACAGCGTAGCAACTACGACACTCTTCGTAAAAAACCTGA
ATTTCTCGACCACAAATGAGAAGTTCCTGGAAGTGTTTCGATCTCTGGATGGCTTTATCACTGGTCGCATCAAGA
CCAAACCTGATCCCAAGCGACCAGGGCAGACCCTCAGCATGGGATTCGGCTTTGCGGATTTCAAAACCAAGGGTC
AAGCCCAGGCTGCTCTTTCAGCTATGAACGGCTACAAGTTGGATCAGCACGAGCTTCTCATCCGCGCATCCCATA
AAGGCAAGGATGCCGCCGAGGAGCGGAGGCGCGAAGATACCGCGAAGAAGGTTGCAGCGCGGAGAACCAAAATCA
TCATCAAGAACTTGCCGTTCCAGGCCACGAAGAAGGACATCAGATCTCTCTTCGGGGCATATGGACAACTTCGGT
CTGTGCGTGTTCCCCAGAAGTTCGATCATACTGCTCGTGGTTTCGGTTTTGCAGACTTTGTAAGCGCTCGCGAAG
CAGAAAATGCCATGGACGCGTTGAAAAACACGCATCTCCTGGGGAGACGATTGGTTTTGGAGTTCGTGAACGAGG
AGGCCGTCGATCCCGAGGAGGAGCTCGCGCGCCTAGAGAAGAAGGTAGGAGAGCAGATGGACAGGGTCAAACTTC
AACAGCTTACTACTGGCGCCGGGCGCAAGAAATTTACTGTAGGAGGGCAGGAGGAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail