Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6130.t1
Gene name
Locationscaffold_16:49922..52161
Strand+
Gene length (bp)2239
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 7.3E-20 52 413

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 77 19
3 92 114 22
4 135 157 22
5 167 189 22
6 196 218 22
7 258 280 22
8 292 314 22
9 350 372 22
10 393 415 22
11 425 447 22
12 454 473 19
13 493 515 22
14 569 591 22
15 601 623 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6130.t1
MSSDGVIFTAPLSQSFGYGIILGLGFAFALLMIFITWALKRYQNEVQTSEMFSTAGRSVKSGLVAAAVVSSWTWA
ATLLQSSAVAYKYGVSGPFFYASGATVQILLFATLAIELKRRAPNAHTFLEVIHARYGTVVHVVFIVFCLMTNIL
VTAMLLTGGSAVMTSLTGVPTAAACFLLPIGVVLYTLFGGIKATFITDYLHTVVILVVIFLFAFSAYATNAELGS
PSKVYDALVAASQRHPVEGNAEGSYLTMRSKEGGVFWVINIVGNFGTVFLDNGYYNKAIAASPVHAFPGYVIGGI
CWFAIPWLCASTMGLSALALEGTQRMSSSDVSAGLVLPFAAVKLLGYSGAVATTLMIFMAVTSAFSAQLIAVSSI
FTYDIYAAYINPSAKGKRLVWISHMSCIVYSIIMAGFATGLYYAGIGMGYLYLLMGVIISSAVFPGAMTLLWKGQ
NRIAAALSPPLGLAVSLIAWLVTAKKQFGTLTVDSTGSNYPMLAGNVAALLSPLVFVPVFTYIFGPQNYDYESMR
AIRKVDDTEVAAAAHVDLELVPGEMGPTQDESEEETRLLNRSAFYARTLTVFMALAFLILWPIPMYGSSYVFSKK
FFTGWVVVGIIWLFCTLFGVVVFPLYEGRASIVRVVRMMSLDLVGKKPKVYRGTKGGADDVATPSGLATPTDTLG
EKDKQTLEREV*
Coding >Pro_DTO377G3_2|g6130.t1
ATGTCGTCCGACGGGGTTATTTTCACAGCGCCTTTGTCTCAGAGCTTTGGATATGGAATTATCTTAGGCCTAGGC
TTTGCCTTTGCCCTACTGATGATCTTCATTACTTGGGCCTTGAAACGCTATCAGAATGAAGTCCAAACATCCGAG
ATGTTCTCAACTGCAGGCCGGTCCGTCAAATCAGGACTGGTTGCAGCCGCCGTTGTTAGTAGTTGGACATGGGCT
GCAACTCTTCTCCAGTCATCTGCAGTCGCATACAAATACGGTGTCTCTGGTCCATTTTTCTACGCATCAGGCGCC
ACTGTCCAGATTCTCCTATTCGCAACACTAGCTATCGAGCTGAAACGCCGTGCGCCGAACGCGCACACTTTCTTG
GAAGTCATCCACGCTCGCTATGGAACCGTCGTGCACGTAGTTTTCATAGTTTTCTGCTTGATGACCAACATTCTG
GTTACTGCGATGCTGCTCACCGGTGGCTCGGCCGTGATGACATCCTTGACTGGAGTGCCCACTGCGGCAGCCTGC
TTCCTGCTCCCAATTGGCGTGGTACTATACACCCTCTTCGGTGGTATTAAGGCTACTTTTATCACAGATTACTTA
CACACCGTGGTAATCCTGGTCGTCATCTTCCTCTTCGCCTTCTCCGCTTATGCCACAAATGCCGAGCTAGGATCT
CCATCAAAGGTGTATGACGCGCTAGTTGCAGCCTCCCAGCGTCACCCTGTTGAGGGTAATGCGGAAGGCAGCTAT
CTGACTATGCGCTCTAAGGAGGGTGGCGTCTTCTGGGTCATCAACATCGTTGGAAACTTTGGCACGGTCTTCTTA
GACAACGGCTACTATAACAAGGCTATCGCCGCCAGTCCCGTCCATGCATTCCCAGGATACGTCATTGGCGGCATC
TGCTGGTTCGCAATTCCCTGGCTATGCGCAAGCACGATGGGCCTCTCCGCACTGGCACTAGAGGGCACGCAGCGC
ATGAGCTCCAGCGACGTGAGCGCCGGGCTAGTGCTCCCCTTTGCAGCAGTCAAGCTGCTCGGCTATAGCGGTGCC
GTCGCCACAACATTGATGATCTTCATGGCCGTGACATCTGCGTTCTCAGCGCAGCTGATTGCCGTCTCTTCGATC
TTCACCTACGATATCTACGCGGCCTACATCAACCCAAGCGCCAAGGGCAAGAGACTTGTCTGGATCTCGCACATG
TCCTGCATTGTGTACTCAATCATCATGGCGGGCTTTGCGACGGGTCTCTACTACGCCGGAATCGGCATGGGATAC
CTCTACCTGCTGATGGGCGTGATCATCTCCTCCGCTGTCTTCCCAGGAGCCATGACCCTTCTTTGGAAGGGCCAG
AACCGAATCGCAGCAGCCCTATCACCGCCCCTCGGTCTGGCAGTTTCTCTCATTGCCTGGCTAGTGACCGCAAAG
AAGCAATTCGGAACCCTAACCGTCGATAGCACTGGCTCCAATTACCCCATGCTAGCCGGCAATGTCGCCGCCCTT
CTCAGCCCACTAGTCTTCGTCCCAGTCTTCACCTACATCTTCGGCCCACAAAACTATGACTACGAATCCATGCGC
GCTATCCGCAAAGTCGACGACACAGAAGTCGCCGCCGCCGCTCATGTCGACCTCGAACTAGTTCCCGGCGAGATG
GGCCCCACGCAAGATGAGAGCGAAGAAGAAACACGCCTGCTCAACCGCTCGGCATTCTACGCGCGCACGCTGACA
GTCTTTATGGCACTTGCATTCCTGATCCTCTGGCCGATCCCGATGTATGGGTCTTCGTATGTGTTCAGCAAGAAG
TTCTTTACGGGATGGGTGGTTGTTGGAATTATTTGGTTGTTCTGTACCCTGTTTGGTGTTGTGGTGTTCCCGTTA
TACGAGGGTCGCGCGAGTATTGTACGTGTAGTGCGGATGATGTCGCTTGATCTGGTGGGGAAGAAGCCCAAGGTT
TATCGAGGAACGAAGGGCGGTGCCGATGATGTGGCTACGCCTTCTGGGCTGGCGACGCCGACGGATACGCTTGGA
GAAAAGGATAAGCAGACCTTGGAGAGGGAGGTTTGA
Transcript >Pro_DTO377G3_2|g6130.t1
ATGTCGTCCGACGGGGTTATTTTCACAGCGCCTTTGTCTCAGAGCTTTGGATATGGAATTATCTTAGGCCTAGGC
TTTGCCTTTGCCCTACTGATGATCTTCATTACTTGGGCCTTGAAACGCTATCAGAATGAAGTCCAAACATCCGAG
ATGTTCTCAACTGCAGGCCGGTCCGTCAAATCAGGACTGGTTGCAGCCGCCGTTGTTAGTAGTTGGACATGGGCT
GCAACTCTTCTCCAGTCATCTGCAGTCGCATACAAATACGGTGTCTCTGGTCCATTTTTCTACGCATCAGGCGCC
ACTGTCCAGATTCTCCTATTCGCAACACTAGCTATCGAGCTGAAACGCCGTGCGCCGAACGCGCACACTTTCTTG
GAAGTCATCCACGCTCGCTATGGAACCGTCGTGCACGTAGTTTTCATAGTTTTCTGCTTGATGACCAACATTCTG
GTTACTGCGATGCTGCTCACCGGTGGCTCGGCCGTGATGACATCCTTGACTGGAGTGCCCACTGCGGCAGCCTGC
TTCCTGCTCCCAATTGGCGTGGTACTATACACCCTCTTCGGTGGTATTAAGGCTACTTTTATCACAGATTACTTA
CACACCGTGGTAATCCTGGTCGTCATCTTCCTCTTCGCCTTCTCCGCTTATGCCACAAATGCCGAGCTAGGATCT
CCATCAAAGGTGTATGACGCGCTAGTTGCAGCCTCCCAGCGTCACCCTGTTGAGGGTAATGCGGAAGGCAGCTAT
CTGACTATGCGCTCTAAGGAGGGTGGCGTCTTCTGGGTCATCAACATCGTTGGAAACTTTGGCACGGTCTTCTTA
GACAACGGCTACTATAACAAGGCTATCGCCGCCAGTCCCGTCCATGCATTCCCAGGATACGTCATTGGCGGCATC
TGCTGGTTCGCAATTCCCTGGCTATGCGCAAGCACGATGGGCCTCTCCGCACTGGCACTAGAGGGCACGCAGCGC
ATGAGCTCCAGCGACGTGAGCGCCGGGCTAGTGCTCCCCTTTGCAGCAGTCAAGCTGCTCGGCTATAGCGGTGCC
GTCGCCACAACATTGATGATCTTCATGGCCGTGACATCTGCGTTCTCAGCGCAGCTGATTGCCGTCTCTTCGATC
TTCACCTACGATATCTACGCGGCCTACATCAACCCAAGCGCCAAGGGCAAGAGACTTGTCTGGATCTCGCACATG
TCCTGCATTGTGTACTCAATCATCATGGCGGGCTTTGCGACGGGTCTCTACTACGCCGGAATCGGCATGGGATAC
CTCTACCTGCTGATGGGCGTGATCATCTCCTCCGCTGTCTTCCCAGGAGCCATGACCCTTCTTTGGAAGGGCCAG
AACCGAATCGCAGCAGCCCTATCACCGCCCCTCGGTCTGGCAGTTTCTCTCATTGCCTGGCTAGTGACCGCAAAG
AAGCAATTCGGAACCCTAACCGTCGATAGCACTGGCTCCAATTACCCCATGCTAGCCGGCAATGTCGCCGCCCTT
CTCAGCCCACTAGTCTTCGTCCCAGTCTTCACCTACATCTTCGGCCCACAAAACTATGACTACGAATCCATGCGC
GCTATCCGCAAAGTCGACGACACAGAAGTCGCCGCCGCCGCTCATGTCGACCTCGAACTAGTTCCCGGCGAGATG
GGCCCCACGCAAGATGAGAGCGAAGAAGAAACACGCCTGCTCAACCGCTCGGCATTCTACGCGCGCACGCTGACA
GTCTTTATGGCACTTGCATTCCTGATCCTCTGGCCGATCCCGATGTATGGGTCTTCGTATGTGTTCAGCAAGAAG
TTCTTTACGGGATGGGTGGTTGTTGGAATTATTTGGTTGTTCTGTACCCTGTTTGGTGTTGTGGTGTTCCCGTTA
TACGAGGGTCGCGCGAGTATTGTACGTGTAGTGCGGATGATGTCGCTTGATCTGGTGGGGAAGAAGCCCAAGGTT
TATCGAGGAACGAAGGGCGGTGCCGATGATGTGGCTACGCCTTCTGGGCTGGCGACGCCGACGGATACGCTTGGA
GAAAAGGATAAGCAGACCTTGGAGAGGGAGGTTTGA
Gene >Pro_DTO377G3_2|g6130.t1
ATGTCGTCCGACGGGGTTATTTTCACAGCGCCTTTGTCTCAGAGCTTTGGATATGGAATTATCTTAGGCCTAGGC
TTTGCCTTTGCCCTACTGATGATCTTCATTACTTGGGCCTTGAAACGGTGCGTCTCTATGCCTTCATCGATATCA
CCCACATAAGCTGACAAAATGCATCCATACAGCTATCAGAATGAAGTCCAAACATCCGAGATGTTCTCAACTGCA
GGCCGGTCCGTCAAATCAGGACTGGTTGCAGCCGCCGTTGTTAGTAGTTGGACATGGGCTGCAACTCTTCTCCAG
TCATCTGCAGTCGCATACAAATACGGTGTCTCTGGTCCATTTTTCTACGCATCAGGTTAGTTCCGGCGGTATGCG
AATGATCTGAAAAGCTCTATATCTAACAGTATGTGTATAGGCGCCACTGTCCAGATTCTCCTATTCGCAACACTA
GCTATCGAGCTGAAACGCCGTGCGCCGAACGCGCACACTTTCTTGGAAGTCATCCACGCTCGCTATGGAACCGTC
GTGCACGTAGTTTTCATAGTTTTCTGCTTGATGACCAACATTCTGGTTACTGCGATGCTGCTCACCGGTGGCTCG
GCCGTGATGACATCCTTGACTGGAGTGCCCACTGCGGCAGCCTGCTTCCTGCTCCCAATTGGCGTGGTACTATAC
ACCCTCTTCGGTGGTATTAAGGCTACTTTTATCACAGATTACTTACACACCGTGGTAATCCTGGTCGTCATCTTC
CTCTTCGCCTTCTCCGCTTATGCCACAAATGCCGAGCTAGGATCTCCATCAAAGGTGTATGACGCGCTAGTTGCA
GCCTCCCAGCGTCACCCTGTTGAGGGTAATGCGGAAGGCAGCTATCTGACTATGCGCTCTAAGGAGGGTGGCGTC
TTCTGGGTCATCAACATCGTTGGAAACTTTGGCACGGTCTTCTTAGACAACGGCTACTATAACAAGGCTATCGCC
GCCAGTCCCGTCCATGCATTCCCAGGATACGTCATTGGCGGCATCTGCTGGTTCGCAATTCCCTGGCTATGCGCA
AGCACGATGGGCCTCTCCGCACTGGCACTAGAGGGCACGCAGCGCATGAGCTCCAGCGACGTGAGCGCCGGGCTA
GTGCTCCCCTTTGCAGCAGTCAAGCTGCTCGGCTATAGCGGTGCCGTCGCCACAACATTGATGATCTTCATGGCC
GTGACATCTGCGTTCTCAGCGCAGCTGATTGCCGTCTCTTCGATCTTCACCTACGATATCTACGCGGCCTACATC
AACCCAAGCGCCAAGGGCAAGAGACTTGTCTGGATCTCGCACATGTCCTGCATTGTGTACTCAATCATCATGGCG
GGCTTTGCGACGGGTCTCTACTACGCCGGAATCGGCATGGGATACCTCTACCTGCTGATGGGCGTGATCATCTCC
TCCGCTGTCTTCCCAGGAGCCATGACCCTTCTTTGGAAGGGCCAGAACCGAATCGCAGCAGCCCTATCACCGCCC
CTCGGTCTGGCAGTTTCTCTCATTGCCTGGCTAGTGACCGCAAAGAAGCAATTCGGAACCCTAACCGTCGATAGC
ACTGGCTCCAAGTAAGCATTCCTTTCTCAACATCCATACTGCAAACCCAAACCTAACAAACCGCCACAGTTACCC
CATGCTAGCCGGCAATGTCGCCGCCCTTCTCAGCCCACTAGTCTTCGTCCCAGTCTTCACCTACATCTTCGGCCC
ACAAAACTATGACTACGAATCCATGCGCGCTATCCGCAAAGTCGACGACACAGAAGTCGCCGCCGCCGCTCATGT
CGACCTCGAACTAGTTCCCGGCGAGATGGGCCCCACGCAAGATGAGAGCGAAGAAGAAACACGCCTGCTCAACCG
CTCGGCATTCTACGCGCGCACGCTGACAGTCTTTATGGCACTTGCATTCCTGATCCTCTGGCCGATCCCGATGTA
TGGGTCTTCGTATGTGTTCAGCAAGAAGTTCTTTACGGGATGGGTGGTTGTTGGAATTATTTGGTTGTTCTGTAC
CCTGTTTGGTGTTGTGGTGTTCCCGTTATACGAGGGTCGCGCGAGTATTGTACGTGTAGTGCGGATGATGTCGCT
TGATCTGGTGGGGAAGAAGCCCAAGGTTTATCGAGGAACGAAGGGCGGTGCCGATGATGTGGCTACGCCTTCTGG
GCTGGCGACGCCGACGGATACGCTTGGAGAAAAGGATAAGCAGACCTTGGAGAGGGAGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail