Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6115.t1
Gene name
Locationscaffold_16:1116..3316
Strand-
Gene length (bp)2200
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11815 DUF3336 Domain of unknown function (DUF3336) 2.4E-50 117 269
PF01734 Patatin Patatin-like phospholipase 4.2E-16 277 466

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004806 triglyceride lipase activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016298 lipase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008152 metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 79.71 48.62 110.79
5d_25C Five days - 25 degrees Celsius 90.52 55.07 125.97
7d_25C Seven days - 25 degrees Celsius 84.67 51.81 117.52
10d_25C Ten days - 25 degrees Celsius 100.32 60.90 139.74
7d_15C Seven days - 15 degrees Celsius 109.95 66.47 153.42
7d_30C Seven days - 30 degrees Celsius 79.91 48.61 111.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.640206 no
3d_25C 7d_25C 0.846169 no
3d_25C 7d_15C 0.153493 no
3d_25C 7d_30C 0.994324 no
3d_25C 10d_25C 0.333251 no
5d_25C 7d_25C 0.827460 no
5d_25C 7d_15C 0.439512 no
5d_25C 7d_30C 0.649788 no
5d_25C 10d_25C 0.719252 no
7d_25C 7d_15C 0.275260 no
7d_25C 7d_30C 0.855435 no
7d_25C 10d_25C 0.511208 no
7d_15C 7d_30C 0.156378 no
7d_15C 10d_25C 0.757928 no
7d_30C 10d_25C 0.337492 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6115.t1
MTTKKKPAVYDPYDPACLPDYDRDFIQPDELDRFEKALNAPEASPLTAINDWRPINQRVRKNRGRRKTPKRSKDE
TREGVLYSVLKWPFLFIVFAWLIVLSFGYALVRVYIVLYEQWVTWRGKRQRLRQELSAQKNYPDWLKAAQALDVH
LGTEKWKKTDEYAYYDHLTVNKVVSQLKQLRKKVEWEMENGRVGSSEVPAIEDLQALLEACVKNNFSGVENPRIY
SETYSGTKELVQEYIDEVHACIQIILDNKQIDKDAKYELFKHLDTNFGRTALCLSGGATFAYYHFGVVRALLDND
VLPEIITGTSGGALVAGLVATRTDDELKQLLVPALAHRIRACHEGLATWIRRWWRTGARFDTMDWARQCAWFCRG
STTFREAYERTGRILNVTCVPSDPHSPTILANYLTCPDCVIWSAVLASAAVPGILNPVVLMTKKRDGTLAPYSFG
HKWKDGSLRTDIPIKALNLHFNVNFTIVSQVNPHINLFFFSSRGTVGRPVTHRRGRGWRGGFLGTAIEQYIKLDL
NKWLRVLRHLELLPRPLGQDWSEIWLQKFSGTVTIWPKTIPSDFIHILSDPTPERLARMIHVGQQSTFSKIQFIQ
NRLKVENAIMKGLQESRTGGRALSPILSRRIRNRENEHADSMVERLDENLPERDGSSYKNESRFGDLSDSMSQST
GSSRPHTPSSRRGSVIEELRRQSAVFFDDPDYYRDEDAVVI*
Coding >Pro_DTO377G3_2|g6115.t1
ATGACCACTAAGAAGAAACCTGCTGTGTACGACCCTTACGATCCGGCCTGTCTCCCTGACTACGACCGCGACTTC
ATTCAGCCAGATGAACTCGACCGATTCGAGAAGGCGCTGAATGCCCCAGAAGCCTCCCCATTGACAGCCATCAAC
GACTGGCGCCCAATCAATCAACGAGTCCGCAAGAATCGTGGCCGCCGCAAAACACCAAAGCGAAGCAAGGATGAA
ACGAGGGAAGGCGTGCTATATTCTGTTTTGAAATGGCCCTTCCTGTTCATTGTATTCGCGTGGCTCATAGTACTG
AGCTTTGGCTATGCTCTGGTGCGTGTCTACATAGTATTGTATGAACAGTGGGTGACATGGCGGGGGAAAAGGCAA
AGGCTGCGTCAGGAACTATCTGCACAGAAAAACTATCCGGACTGGCTGAAAGCGGCTCAAGCATTGGACGTCCAT
CTCGGAACCGAAAAGTGGAAAAAGACAGACGAATACGCTTATTACGACCATCTCACTGTCAACAAGGTGGTATCG
CAGCTGAAGCAGCTGAGGAAGAAGGTGGAATGGGAAATGGAGAATGGTCGGGTCGGCTCTAGCGAGGTACCTGCT
ATTGAAGATCTTCAAGCACTTTTAGAGGCTTGCGTCAAGAACAACTTTTCCGGTGTGGAAAATCCTCGAATATAT
AGCGAGACATACTCGGGAACAAAGGAGCTGGTTCAGGAATACATCGACGAGGTGCACGCATGCATACAGATCATT
TTGGACAACAAACAGATTGACAAGGATGCCAAGTATGAGCTTTTCAAACACCTCGATACAAACTTTGGACGCACC
GCTCTTTGTCTTTCGGGTGGTGCTACATTCGCTTACTACCACTTCGGGGTGGTAAGAGCGCTGCTGGATAATGAT
GTCCTCCCAGAAATCATAACTGGCACATCAGGCGGAGCACTTGTGGCGGGACTAGTCGCAACTCGGACAGATGAT
GAGCTAAAGCAGCTGCTTGTTCCAGCTTTAGCACATCGGATTCGCGCATGCCATGAAGGACTGGCAACTTGGATC
CGTCGCTGGTGGCGAACTGGTGCTCGGTTCGATACTATGGACTGGGCTCGACAATGCGCCTGGTTCTGCAGGGGT
TCAACGACCTTTCGTGAAGCTTACGAGCGGACCGGGCGTATTTTGAATGTCACCTGCGTGCCCTCAGATCCTCAC
TCACCGACTATCCTAGCCAATTATCTGACATGCCCCGACTGTGTCATATGGAGTGCCGTGCTTGCTTCGGCGGCT
GTTCCGGGAATTTTAAACCCTGTTGTATTAATGACTAAAAAGCGTGATGGCACTCTCGCGCCTTATTCGTTTGGT
CACAAATGGAAGGATGGTAGCCTACGGACTGATATACCTATCAAAGCGTTGAACCTGCATTTCAACGTCAACTTT
ACGATTGTATCCCAGGTCAATCCCCACATCAACCTCTTCTTCTTTAGTTCTAGAGGGACAGTAGGGCGACCAGTC
ACACACCGCAGGGGCCGTGGCTGGCGCGGGGGCTTCCTCGGCACCGCAATCGAGCAGTACATCAAATTAGACCTC
AACAAATGGCTTCGAGTTCTTCGGCATTTAGAGCTCCTCCCACGACCTTTGGGCCAGGATTGGAGCGAGATCTGG
TTGCAAAAGTTCAGTGGCACTGTAACTATCTGGCCAAAAACGATCCCCTCCGATTTCATCCACATTCTTTCCGAT
CCCACTCCTGAAAGGCTCGCCCGCATGATACATGTCGGCCAGCAGAGTACTTTCTCCAAAATCCAATTTATCCAA
AACCGGCTCAAGGTCGAGAATGCGATCATGAAAGGACTCCAAGAATCTAGAACGGGTGGACGTGCGCTCTCCCCG
ATCCTGTCCCGTCGAATCCGCAATCGGGAAAATGAACATGCAGACTCTATGGTGGAGCGTTTAGATGAAAATCTC
CCCGAGCGCGATGGATCTAGCTACAAGAACGAGTCGCGTTTTGGTGACTTGTCAGATAGCATGTCTCAATCAACC
GGCTCATCACGTCCTCATACCCCCAGTTCCCGGCGGGGAAGCGTGATCGAGGAACTACGACGCCAGTCTGCAGTT
TTCTTTGACGATCCAGACTACTATCGGGACGAGGATGCCGTGGTCATCTGA
Transcript >Pro_DTO377G3_2|g6115.t1
ATGACCACTAAGAAGAAACCTGCTGTGTACGACCCTTACGATCCGGCCTGTCTCCCTGACTACGACCGCGACTTC
ATTCAGCCAGATGAACTCGACCGATTCGAGAAGGCGCTGAATGCCCCAGAAGCCTCCCCATTGACAGCCATCAAC
GACTGGCGCCCAATCAATCAACGAGTCCGCAAGAATCGTGGCCGCCGCAAAACACCAAAGCGAAGCAAGGATGAA
ACGAGGGAAGGCGTGCTATATTCTGTTTTGAAATGGCCCTTCCTGTTCATTGTATTCGCGTGGCTCATAGTACTG
AGCTTTGGCTATGCTCTGGTGCGTGTCTACATAGTATTGTATGAACAGTGGGTGACATGGCGGGGGAAAAGGCAA
AGGCTGCGTCAGGAACTATCTGCACAGAAAAACTATCCGGACTGGCTGAAAGCGGCTCAAGCATTGGACGTCCAT
CTCGGAACCGAAAAGTGGAAAAAGACAGACGAATACGCTTATTACGACCATCTCACTGTCAACAAGGTGGTATCG
CAGCTGAAGCAGCTGAGGAAGAAGGTGGAATGGGAAATGGAGAATGGTCGGGTCGGCTCTAGCGAGGTACCTGCT
ATTGAAGATCTTCAAGCACTTTTAGAGGCTTGCGTCAAGAACAACTTTTCCGGTGTGGAAAATCCTCGAATATAT
AGCGAGACATACTCGGGAACAAAGGAGCTGGTTCAGGAATACATCGACGAGGTGCACGCATGCATACAGATCATT
TTGGACAACAAACAGATTGACAAGGATGCCAAGTATGAGCTTTTCAAACACCTCGATACAAACTTTGGACGCACC
GCTCTTTGTCTTTCGGGTGGTGCTACATTCGCTTACTACCACTTCGGGGTGGTAAGAGCGCTGCTGGATAATGAT
GTCCTCCCAGAAATCATAACTGGCACATCAGGCGGAGCACTTGTGGCGGGACTAGTCGCAACTCGGACAGATGAT
GAGCTAAAGCAGCTGCTTGTTCCAGCTTTAGCACATCGGATTCGCGCATGCCATGAAGGACTGGCAACTTGGATC
CGTCGCTGGTGGCGAACTGGTGCTCGGTTCGATACTATGGACTGGGCTCGACAATGCGCCTGGTTCTGCAGGGGT
TCAACGACCTTTCGTGAAGCTTACGAGCGGACCGGGCGTATTTTGAATGTCACCTGCGTGCCCTCAGATCCTCAC
TCACCGACTATCCTAGCCAATTATCTGACATGCCCCGACTGTGTCATATGGAGTGCCGTGCTTGCTTCGGCGGCT
GTTCCGGGAATTTTAAACCCTGTTGTATTAATGACTAAAAAGCGTGATGGCACTCTCGCGCCTTATTCGTTTGGT
CACAAATGGAAGGATGGTAGCCTACGGACTGATATACCTATCAAAGCGTTGAACCTGCATTTCAACGTCAACTTT
ACGATTGTATCCCAGGTCAATCCCCACATCAACCTCTTCTTCTTTAGTTCTAGAGGGACAGTAGGGCGACCAGTC
ACACACCGCAGGGGCCGTGGCTGGCGCGGGGGCTTCCTCGGCACCGCAATCGAGCAGTACATCAAATTAGACCTC
AACAAATGGCTTCGAGTTCTTCGGCATTTAGAGCTCCTCCCACGACCTTTGGGCCAGGATTGGAGCGAGATCTGG
TTGCAAAAGTTCAGTGGCACTGTAACTATCTGGCCAAAAACGATCCCCTCCGATTTCATCCACATTCTTTCCGAT
CCCACTCCTGAAAGGCTCGCCCGCATGATACATGTCGGCCAGCAGAGTACTTTCTCCAAAATCCAATTTATCCAA
AACCGGCTCAAGGTCGAGAATGCGATCATGAAAGGACTCCAAGAATCTAGAACGGGTGGACGTGCGCTCTCCCCG
ATCCTGTCCCGTCGAATCCGCAATCGGGAAAATGAACATGCAGACTCTATGGTGGAGCGTTTAGATGAAAATCTC
CCCGAGCGCGATGGATCTAGCTACAAGAACGAGTCGCGTTTTGGTGACTTGTCAGATAGCATGTCTCAATCAACC
GGCTCATCACGTCCTCATACCCCCAGTTCCCGGCGGGGAAGCGTGATCGAGGAACTACGACGCCAGTCTGCAGTT
TTCTTTGACGATCCAGACTACTATCGGGACGAGGATGCCGTGGTCATCTGA
Gene >Pro_DTO377G3_2|g6115.t1
ATGACCACTAAGAAGAAACCTGCTGTGTACGACCCTTACGATCCGGCCTGTCTCCCTGACTACGACCGCGACTTC
ATTCAGCCAGATGAACTCGACCGATTCGAGAAGGCGCTGAATGCCCCAGAAGCCTCCCCATTGACAGCCATCAAC
GACTGGCGCCCAATCAATCAACGAGTCCGCAAGAATCGTGGCCGCCGCAAAACACCAAAGCGAAGCAAGGATGAA
ACGAGGGAAGGCGTGCTATATTCTGTTTTGAAATGGCCCTTCCTGTTCATTGTATTCGCGTGGCTCATAGTACTG
AGCTTTGGCTATGCTCTGGTGCGTGTCTACATAGTATTGTATGAACAGTGGGTGACATGGCGGGGGAAAAGGCAA
AGGCTGCGTCAGGAACTATCTGCACAGAAAAACTATCCGGACTGGCTGAAAGCGGCTCAAGCATTGGACGTCCAT
CTCGGAACCGAAAAGTGGAAAAAGACAGACGAATACGCTTATTACGACCATCTCACTGTCAACAAGGTGGTATCG
CAGCTGAAGCAGCTGAGGAAGAAGGTGGAATGGGAAATGGAGAATGGTCGGGTCGGCTCTAGCGAGGTACCTGCT
ATTGAAGATCTTCAAGCACTTTTAGAGGCTTGCGTCAAGAACAACTTTTCCGGTGTGGAAAATCCTCGAATATAT
AGCGAGACATACTCGGGAACAAAGGAGCTGGTTCAGGAATACATCGACGAGGTGCACGCATGCATACAGATCATT
TTGGACAACAAACAGATTGACAAGGATGCCAAGTATGAGCTTTTCAAACACCTCGATACAAACTTTGGACGCACC
GCTCTTTGTCTTTCGGGTGGTGCTACATTCGCTTACTACCACTTCGGGGTGGTAAGAGCGCTGCTGGATAATGAT
GTCCTCCCAGAAATCATAACTGGCACATCAGGCGGAGCACTTGTGGCGGGACTAGTCGCAACTCGGACAGATGAT
GAGCTAAAGCAGCTGCTTGTTCCAGCTTTAGCACATCGGATTCGCGCATGCCATGAAGGACTGGCAACTTGGATC
CGTCGCTGGTGGCGAACTGGTGCTCGGTTCGATACTATGGACTGGGCTCGACAATGCGCCTGGTTCTGCAGGGGT
TCAACGACCTTTCGTGAAGCTTACGAGCGGACCGGGCGTATTTTGAATGTCACCTGCGTGCCCTCAGATCCTCAC
TCACCGACTATCCTAGCCAATTATCTGACATGCCCCGACTGTGTCATATGGAGTGCCGTGCTTGCTTCGGCGGCT
GTTCCGGGAATTTTAAACCCTGTTGTATTAATGACTAAAAAGCGTGATGGCACTCTCGCGCCTTATTCGTTTGGT
CACAAATGGAAGGATGGTAGCCTACGGACTGATATACCTATCAAAGCGTTGAACCTGCATTTCAACGTCAACTTT
ACGATTGTATCCCAGGTGAGATTCCTTTCCTACGTTTAAACCTTTGCCACTAACACTACCCTAGGTCAATCCCCA
CATCAACCTCTTCTTCTTTAGTTCTAGAGGGACAGTAGGGCGACCAGTCACACACCGCAGGGGCCGTGGCTGGCG
CGGGGGCTTCCTCGGCACCGCAATCGAGCAGTACATCAAATTAGACCTCAACAAATGGCTTCGAGTTCTTCGGCA
TTTAGAGCTCCTCCCACGACCTTTGGGCCAGGATTGGAGCGAGATCTGGTTGCAAAAGTTCAGTGGCACTGTAAC
TATCTGGCCAAAAACGATCCCCTCCGATTTCATCCACATTCTTTCCGATCCCACTCCTGAAAGGCTCGCCCGCAT
GATACATGTCGGCCAGCAGAGTACTTTCTCCAAAATCCAATTTATCCAAAACCGGCTCAAGGTCGAGAATGCGAT
CATGAAAGGACTCCAAGAATCTAGAACGGGTGGACGTGCGCTCTCCCCGATCCTGTCCCGTCGAATCCGCAATCG
GGAAAATGAACATGCAGACTCTATGGTGGAGCGTTTAGATGAAAATCTCCCCGAGCGCGATGGATCTAGCTACAA
GAACGAGTCGCGTTTTGGTGACTTGTCAGATAGCATGTCTCAATCAACCGGCTCATCACGTCCTCATACCCCCAG
TTCCCGGCGGGGAAGCGTGATCGAGGAACTACGACGCCAGTCTGCAGTTTTCTTTGACGATCCAGACTACTATCG
GGACGAGGATGCCGTGGTCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail