Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6094.t1
Gene name
Locationscaffold_15:587680..588422
Strand+
Gene length (bp)742
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 1.1E-92 1 208

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0097020 COPII receptor activity Yes
GO:0051179 localization No
GO:0048193 Golgi vesicle transport No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0038024 cargo receptor activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0016192 vesicle-mediated transport No
GO:0046907 intracellular transport No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 52 74 22
3 95 112 17
4 142 164 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6094.t1
MWILPLVGYFGVVVGFAFLTLAIASGLYYLSELVEEHTVIARRLLTRLIYGIVAIQVLLMIFDRFPVSLSLLSIG
SHMVYASNLRRFPIVKLSDPLFLLSCLLVGLNHWLWFRHFSKPLPPSNNWRQPYGVNYDEMPSFSEVASYFGLCI
WLVPFALFVSLSAGENVLPSMGSEYVTGEHAKPAGLGPSGSKSKNKGMAKALVDGVRDWTRETGEVMGLWRGEST
RRF*
Coding >Pro_DTO377G3_2|g6094.t1
ATGTGGATTTTACCGCTAGTCGGATATTTCGGGGTGGTTGTCGGGTTTGCGTTTCTCACCTTGGCTATAGCTTCG
GGACTCTACTATCTATCCGAGCTCGTGGAAGAACACACGGTTATCGCCCGCCGTCTGTTGACCCGTTTGATCTAC
GGCATCGTCGCGATACAAGTTCTGCTTATGATATTTGACCGTTTCCCCGTGTCACTATCTCTGCTCAGCATTGGT
TCGCACATGGTCTACGCTAGCAATCTGCGCCGATTCCCCATCGTGAAACTATCCGATCCTCTTTTCCTTCTATCC
TGCCTTCTAGTTGGTCTTAACCACTGGCTATGGTTCCGCCACTTCTCGAAGCCCTTGCCTCCGTCGAACAACTGG
CGTCAACCGTATGGAGTCAATTACGATGAGATGCCCTCTTTCTCTGAAGTGGCCTCATACTTTGGGCTGTGCATT
TGGCTTGTTCCATTCGCCCTGTTTGTTAGTTTGAGCGCGGGGGAAAACGTGTTGCCAAGCATGGGCTCCGAATAC
GTCACCGGGGAACATGCCAAACCCGCTGGACTCGGTCCCTCTGGTAGCAAGTCCAAGAACAAGGGAATGGCCAAG
GCCTTGGTGGATGGTGTCCGAGATTGGACAAGGGAGACCGGTGAAGTCATGGGTCTCTGGAGAGGAGAAAGTACA
AGACGATTCTGA
Transcript >Pro_DTO377G3_2|g6094.t1
ATGTGGATTTTACCGCTAGTCGGATATTTCGGGGTGGTTGTCGGGTTTGCGTTTCTCACCTTGGCTATAGCTTCG
GGACTCTACTATCTATCCGAGCTCGTGGAAGAACACACGGTTATCGCCCGCCGTCTGTTGACCCGTTTGATCTAC
GGCATCGTCGCGATACAAGTTCTGCTTATGATATTTGACCGTTTCCCCGTGTCACTATCTCTGCTCAGCATTGGT
TCGCACATGGTCTACGCTAGCAATCTGCGCCGATTCCCCATCGTGAAACTATCCGATCCTCTTTTCCTTCTATCC
TGCCTTCTAGTTGGTCTTAACCACTGGCTATGGTTCCGCCACTTCTCGAAGCCCTTGCCTCCGTCGAACAACTGG
CGTCAACCGTATGGAGTCAATTACGATGAGATGCCCTCTTTCTCTGAAGTGGCCTCATACTTTGGGCTGTGCATT
TGGCTTGTTCCATTCGCCCTGTTTGTTAGTTTGAGCGCGGGGGAAAACGTGTTGCCAAGCATGGGCTCCGAATAC
GTCACCGGGGAACATGCCAAACCCGCTGGACTCGGTCCCTCTGGTAGCAAGTCCAAGAACAAGGGAATGGCCAAG
GCCTTGGTGGATGGTGTCCGAGATTGGACAAGGGAGACCGGTGAAGTCATGGGTCTCTGGAGAGGAGAAAGTACA
AGACGATTCTGA
Gene >Pro_DTO377G3_2|g6094.t1
ATGTGGATTTTACCGCTAGTCGGATATTTCGGGGTGGTTGTCGGGTTTGCGTTTCTCACCTTGGCTATAGGTATG
GGACATGGAGTCCTGACATGAATGGGCAAAAGCTGACTTGGAAACTCCAGCTTCGGGACTCTACTATCTATCCGA
GCTCGTGGAAGAACACACGGTTATCGCCCGCCGTCTGTTGACCCGTTTGATCTACGGCATCGTCGCGATACAAGT
TCTGCTTATGATATTTGACCGTTTCCCCGTGTCACTATCTCTGCTCAGCATTGGTTCGCACATGGTCTACGCTAG
CAATCTGCGCCGATTCCCCATCGTGAAACTATCCGATCCTCTTTTCCTTCTATCCTGCCTTCTAGTTGGTCTTAA
CCACTGGCTATGGTTCCGCCACTTCTCGAAGCCCTTGCCTCCGTCGAACAACTGGCGTCAACCGTATGGAGTCAA
TTACGATGAGATGCCCTCTTTCTCTGAAGTGGCCTCATACTTTGGGCTGTGCATTTGGCTTGTTCCATTCGCCCT
GTTTGTTAGTTTGAGCGCGGGGGAAAACGTGTTGCCAAGCATGGGCTCCGAATACGTCACCGGGGAACATGCCAA
ACCCGCTGGACTCGGTCCCTCTGGTAGCAAGTCCAAGAACAAGGGAATGGCCAAGGCCTTGGTGGATGGTGTCCG
AGATTGGACAAGGGAGACCGGTGAAGTCATGGGTCTCTGGAGAGGAGAAAGTACAAGACGATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail