Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6074.t1
Gene name
Locationscaffold_15:545047..548310
Strand-
Gene length (bp)3263
Transcript length (bp)3135
Coding sequence length (bp)3135
Protein length (aa) 1045

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 7.7E-05 302 338
PF05057 DUF676 Putative serine esterase (DUF676) 1.4E-27 465 613

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.18 10.69 25.67
5d_25C Five days - 25 degrees Celsius 23.67 14.19 33.15
7d_25C Seven days - 25 degrees Celsius 23.24 13.91 32.57
10d_25C Ten days - 25 degrees Celsius 25.01 14.98 35.05
7d_15C Seven days - 15 degrees Celsius 23.12 13.84 32.41
7d_30C Seven days - 30 degrees Celsius 23.84 14.31 33.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.270887 no
3d_25C 7d_25C 0.315640 no
3d_25C 7d_15C 0.323054 no
3d_25C 7d_30C 0.260752 no
3d_25C 10d_25C 0.164929 no
5d_25C 7d_25C 0.960042 no
5d_25C 7d_15C 0.947285 no
5d_25C 7d_30C 0.985095 no
5d_25C 10d_25C 0.867253 no
7d_25C 7d_15C 0.989263 no
7d_25C 7d_30C 0.944111 no
7d_25C 10d_25C 0.816438 no
7d_15C 7d_30C 0.933134 no
7d_15C 10d_25C 0.802525 no
7d_30C 10d_25C 0.886153 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6074.t1
MLITARTYSASQTPDQGAAQPSNQRSRFHTFSGWETIPVDTKEPTDMLLIHQVGSVRVGEVVRYTVTYTPAADPI
LPIPSNLYVRVKNTSAIPLRAAYLHGPYTLYAACYPTKFDPNTKYERQDLEGTPQFEPYLKAGGGWDAVIKVPAN
LQEAHDFGSPGQGGPASGHSVSWIVEIQSQVIFSSSAAVHFELLVGRDEKSLAYSSGGTWSSGNSSPGPPAKLQD
HWLPGTRGSQVLASKGVYSKSIALQVDDTTSLWSSPPFPSAKPASKSVERKSHDSQPVCDNPVPEESTEAPMKSA
KKKKVHLVLLTHGLHSNLGADMLYLKESIDTGMRNSKKNKRQARDPHASPVVDRENPTSKSSHTEEQNSQSGDNS
DDDDEEQVIVRGFSGNAVRTERGIQYLGKRLAKYVLLLTYPDQPYFPLRGSKPSPFARPFSARKERAEPFSHSAE
STPQENAHEFQDEDHAYQITSISFIAHSLGGLIQTYAIAYIQKHSPQFFEQIRPVNFIALATPFLGLSNENPMYV
RFALDLGLVGRTGQDLGLSWTAPKVRSGWGAIIAGRGESAKDPGHSDPGSKPLLRILPCGPAYEVLKKFQHRTVY
SNVVNDGIVPLRTSSLLFLDWKGLDRVEKARRDNGLVGTMAEWGWAELTGANSKSPRLARHDGELPLNLPMEAGH
HHAYSATKVPPRPKDDVSDEDTISPRPAQFLAPSSHVSSNKVSEEGVLKENIPGNTSHSPMDSFFSLFRPTQNKN
PPNSKNARIYKRSQTLSTFETGDSDSTMPINHDHDHEGMHTPPKTTFFECAGDLLMPPLPPAEFISDPASRPRTI
FHDRIYHPEDIPPPLPVKRRILAFGSPQGKQSNSQNPPADKESGLKVEEKIARAYHRDLTWRKVLVRLEPDAHNN
IIVRRMFTNAYGWPVVKHLVDTHFSHTLTAETDDSLKQNMEMAKSPNVGPTSSGDEVEGQSDPVDPKSIRDTDNL
PNVSDLHISKDGSSGPSDISRAEDESHIGTRDRNLVSSQDSARWTDREVVEDDSESGFEVKTNAGFRHI*
Coding >Pro_DTO377G3_2|g6074.t1
ATGCTGATCACTGCGCGCACCTATTCGGCCTCCCAGACCCCAGACCAAGGTGCAGCACAGCCTAGCAATCAAAGG
TCGCGTTTTCATACCTTCTCCGGCTGGGAAACAATTCCGGTGGATACAAAGGAACCGACCGACATGTTGTTAATC
CATCAAGTTGGTAGTGTCCGTGTTGGGGAAGTCGTTAGATACACGGTTACGTACACTCCGGCGGCCGACCCGATC
CTGCCCATCCCTTCAAATCTCTACGTGAGGGTGAAGAACACATCTGCCATCCCACTGCGCGCCGCATACCTCCAT
GGCCCGTACACGCTATACGCCGCGTGCTATCCCACAAAGTTCGACCCCAACACCAAATATGAGCGACAGGATCTG
GAGGGTACACCGCAGTTTGAGCCCTACCTTAAGGCCGGAGGTGGTTGGGACGCCGTCATCAAGGTGCCGGCTAAC
CTCCAGGAAGCACACGACTTTGGCTCTCCGGGTCAAGGTGGACCGGCAAGTGGACATAGCGTTAGCTGGATTGTT
GAGATTCAATCGCAGGTGATATTCTCAAGTAGTGCAGCGGTGCATTTTGAGCTTCTTGTGGGTCGTGATGAAAAG
TCGCTGGCATATTCCTCGGGCGGTACATGGAGTAGTGGAAATAGCTCTCCAGGGCCTCCGGCAAAGTTACAAGAC
CATTGGCTGCCTGGAACTAGAGGTAGTCAGGTGCTTGCCTCGAAAGGCGTGTACTCAAAATCAATCGCTCTTCAA
GTTGACGATACAACTAGTCTATGGAGCAGTCCGCCATTCCCCTCAGCGAAGCCTGCTTCCAAAAGCGTTGAACGG
AAGAGTCATGACTCGCAACCCGTGTGTGATAATCCAGTACCGGAGGAGTCTACGGAAGCTCCGATGAAAAGCGCC
AAAAAGAAGAAGGTGCATCTCGTGTTACTGACACATGGGTTGCACAGCAACCTCGGTGCAGACATGCTCTATTTG
AAGGAGAGCATTGACACAGGCATGAGAAATTCCAAGAAGAATAAACGTCAAGCCAGAGATCCCCATGCTAGCCCT
GTTGTAGACCGAGAAAACCCGACAAGTAAATCCAGTCATACTGAAGAGCAAAATAGCCAGTCTGGTGATAACTCC
GACGATGACGATGAAGAGCAAGTCATTGTTAGAGGGTTCTCTGGCAATGCTGTTCGGACTGAGCGTGGGATTCAA
TACCTCGGCAAACGGCTGGCCAAATATGTCCTGCTTCTCACATATCCCGATCAACCCTATTTCCCTCTCAGAGGC
TCAAAGCCGAGCCCATTTGCCCGGCCTTTTAGTGCTCGCAAGGAGCGAGCTGAACCATTTTCTCATTCGGCTGAA
TCAACCCCTCAAGAAAATGCCCATGAATTTCAAGATGAAGACCATGCTTACCAGATTACAAGCATTAGTTTCATT
GCCCATTCTCTTGGCGGGCTGATTCAGACATATGCAATCGCATATATCCAGAAGCACTCGCCTCAGTTCTTTGAG
CAAATCAGACCCGTTAACTTTATTGCCCTTGCAACCCCTTTTCTTGGTCTCAGCAATGAGAATCCAATGTATGTT
CGATTTGCATTGGATCTAGGTCTAGTTGGTCGTACCGGCCAAGATCTCGGGTTGAGTTGGACGGCACCGAAAGTT
CGAAGTGGCTGGGGTGCCATTATTGCTGGAAGAGGAGAGTCTGCAAAAGACCCCGGCCATTCAGATCCTGGCTCC
AAGCCACTTCTTCGGATTCTTCCTTGTGGTCCTGCCTACGAGGTTCTTAAGAAATTCCAGCACCGCACAGTCTAT
TCGAATGTGGTGAATGATGGGATTGTTCCTTTGCGGACGTCTTCTCTTTTGTTCTTGGACTGGAAAGGTTTGGAT
CGAGTTGAAAAAGCGAGGAGGGACAATGGACTTGTTGGAACCATGGCCGAATGGGGGTGGGCAGAGTTGACAGGC
GCCAACTCGAAATCCCCGCGACTTGCTCGCCACGATGGAGAGTTGCCTTTGAATCTCCCAATGGAGGCCGGTCAT
CATCATGCATATTCTGCGACCAAGGTTCCCCCAAGGCCCAAAGACGATGTCTCTGACGAAGATACAATCTCCCCG
AGGCCGGCACAATTCCTGGCACCATCCAGTCATGTGTCCAGCAACAAAGTTTCAGAGGAAGGTGTTCTGAAAGAA
AACATCCCTGGAAATACCTCTCACAGTCCCATGGACAGCTTTTTTTCTCTGTTTCGCCCAACTCAGAACAAGAAT
CCCCCCAATAGCAAGAATGCTAGAATTTATAAGCGTAGCCAGACCCTGAGCACTTTTGAGACTGGCGACAGCGAT
AGCACAATGCCCATTAATCATGACCATGACCACGAAGGAATGCACACCCCTCCAAAGACAACATTTTTCGAGTGT
GCTGGAGACTTGTTGATGCCGCCTTTACCACCCGCGGAATTCATTTCAGACCCTGCCTCACGACCCCGGACAATC
TTCCACGACCGCATCTACCACCCAGAGGATATACCACCCCCTTTACCGGTAAAACGACGCATATTGGCATTTGGT
TCGCCACAGGGCAAGCAATCAAACTCTCAGAATCCGCCTGCAGATAAAGAAAGCGGCCTCAAGGTCGAAGAAAAA
ATCGCGAGAGCCTATCACCGTGATCTGACTTGGCGTAAGGTTCTTGTCCGACTTGAGCCTGATGCCCACAATAAC
ATTATTGTGCGGCGCATGTTCACCAATGCCTATGGCTGGCCTGTTGTGAAGCACTTGGTTGATACACACTTCAGC
CACACTCTCACTGCGGAAACCGACGATTCTCTGAAGCAAAATATGGAGATGGCCAAGTCTCCAAATGTTGGTCCG
ACTAGCTCTGGTGACGAGGTTGAAGGGCAGTCCGATCCTGTCGATCCAAAGTCAATAAGAGATACAGACAATTTG
CCAAATGTATCCGATCTCCATATATCGAAAGATGGATCTTCTGGCCCAAGTGATATCTCAAGGGCCGAAGATGAA
TCGCACATAGGCACCCGTGACAGAAATCTTGTATCGAGTCAGGATTCAGCACGATGGACTGATCGTGAAGTTGTC
GAGGATGACAGCGAGTCCGGCTTCGAAGTGAAGACCAACGCTGGTTTCCGTCACATATAG
Transcript >Pro_DTO377G3_2|g6074.t1
ATGCTGATCACTGCGCGCACCTATTCGGCCTCCCAGACCCCAGACCAAGGTGCAGCACAGCCTAGCAATCAAAGG
TCGCGTTTTCATACCTTCTCCGGCTGGGAAACAATTCCGGTGGATACAAAGGAACCGACCGACATGTTGTTAATC
CATCAAGTTGGTAGTGTCCGTGTTGGGGAAGTCGTTAGATACACGGTTACGTACACTCCGGCGGCCGACCCGATC
CTGCCCATCCCTTCAAATCTCTACGTGAGGGTGAAGAACACATCTGCCATCCCACTGCGCGCCGCATACCTCCAT
GGCCCGTACACGCTATACGCCGCGTGCTATCCCACAAAGTTCGACCCCAACACCAAATATGAGCGACAGGATCTG
GAGGGTACACCGCAGTTTGAGCCCTACCTTAAGGCCGGAGGTGGTTGGGACGCCGTCATCAAGGTGCCGGCTAAC
CTCCAGGAAGCACACGACTTTGGCTCTCCGGGTCAAGGTGGACCGGCAAGTGGACATAGCGTTAGCTGGATTGTT
GAGATTCAATCGCAGGTGATATTCTCAAGTAGTGCAGCGGTGCATTTTGAGCTTCTTGTGGGTCGTGATGAAAAG
TCGCTGGCATATTCCTCGGGCGGTACATGGAGTAGTGGAAATAGCTCTCCAGGGCCTCCGGCAAAGTTACAAGAC
CATTGGCTGCCTGGAACTAGAGGTAGTCAGGTGCTTGCCTCGAAAGGCGTGTACTCAAAATCAATCGCTCTTCAA
GTTGACGATACAACTAGTCTATGGAGCAGTCCGCCATTCCCCTCAGCGAAGCCTGCTTCCAAAAGCGTTGAACGG
AAGAGTCATGACTCGCAACCCGTGTGTGATAATCCAGTACCGGAGGAGTCTACGGAAGCTCCGATGAAAAGCGCC
AAAAAGAAGAAGGTGCATCTCGTGTTACTGACACATGGGTTGCACAGCAACCTCGGTGCAGACATGCTCTATTTG
AAGGAGAGCATTGACACAGGCATGAGAAATTCCAAGAAGAATAAACGTCAAGCCAGAGATCCCCATGCTAGCCCT
GTTGTAGACCGAGAAAACCCGACAAGTAAATCCAGTCATACTGAAGAGCAAAATAGCCAGTCTGGTGATAACTCC
GACGATGACGATGAAGAGCAAGTCATTGTTAGAGGGTTCTCTGGCAATGCTGTTCGGACTGAGCGTGGGATTCAA
TACCTCGGCAAACGGCTGGCCAAATATGTCCTGCTTCTCACATATCCCGATCAACCCTATTTCCCTCTCAGAGGC
TCAAAGCCGAGCCCATTTGCCCGGCCTTTTAGTGCTCGCAAGGAGCGAGCTGAACCATTTTCTCATTCGGCTGAA
TCAACCCCTCAAGAAAATGCCCATGAATTTCAAGATGAAGACCATGCTTACCAGATTACAAGCATTAGTTTCATT
GCCCATTCTCTTGGCGGGCTGATTCAGACATATGCAATCGCATATATCCAGAAGCACTCGCCTCAGTTCTTTGAG
CAAATCAGACCCGTTAACTTTATTGCCCTTGCAACCCCTTTTCTTGGTCTCAGCAATGAGAATCCAATGTATGTT
CGATTTGCATTGGATCTAGGTCTAGTTGGTCGTACCGGCCAAGATCTCGGGTTGAGTTGGACGGCACCGAAAGTT
CGAAGTGGCTGGGGTGCCATTATTGCTGGAAGAGGAGAGTCTGCAAAAGACCCCGGCCATTCAGATCCTGGCTCC
AAGCCACTTCTTCGGATTCTTCCTTGTGGTCCTGCCTACGAGGTTCTTAAGAAATTCCAGCACCGCACAGTCTAT
TCGAATGTGGTGAATGATGGGATTGTTCCTTTGCGGACGTCTTCTCTTTTGTTCTTGGACTGGAAAGGTTTGGAT
CGAGTTGAAAAAGCGAGGAGGGACAATGGACTTGTTGGAACCATGGCCGAATGGGGGTGGGCAGAGTTGACAGGC
GCCAACTCGAAATCCCCGCGACTTGCTCGCCACGATGGAGAGTTGCCTTTGAATCTCCCAATGGAGGCCGGTCAT
CATCATGCATATTCTGCGACCAAGGTTCCCCCAAGGCCCAAAGACGATGTCTCTGACGAAGATACAATCTCCCCG
AGGCCGGCACAATTCCTGGCACCATCCAGTCATGTGTCCAGCAACAAAGTTTCAGAGGAAGGTGTTCTGAAAGAA
AACATCCCTGGAAATACCTCTCACAGTCCCATGGACAGCTTTTTTTCTCTGTTTCGCCCAACTCAGAACAAGAAT
CCCCCCAATAGCAAGAATGCTAGAATTTATAAGCGTAGCCAGACCCTGAGCACTTTTGAGACTGGCGACAGCGAT
AGCACAATGCCCATTAATCATGACCATGACCACGAAGGAATGCACACCCCTCCAAAGACAACATTTTTCGAGTGT
GCTGGAGACTTGTTGATGCCGCCTTTACCACCCGCGGAATTCATTTCAGACCCTGCCTCACGACCCCGGACAATC
TTCCACGACCGCATCTACCACCCAGAGGATATACCACCCCCTTTACCGGTAAAACGACGCATATTGGCATTTGGT
TCGCCACAGGGCAAGCAATCAAACTCTCAGAATCCGCCTGCAGATAAAGAAAGCGGCCTCAAGGTCGAAGAAAAA
ATCGCGAGAGCCTATCACCGTGATCTGACTTGGCGTAAGGTTCTTGTCCGACTTGAGCCTGATGCCCACAATAAC
ATTATTGTGCGGCGCATGTTCACCAATGCCTATGGCTGGCCTGTTGTGAAGCACTTGGTTGATACACACTTCAGC
CACACTCTCACTGCGGAAACCGACGATTCTCTGAAGCAAAATATGGAGATGGCCAAGTCTCCAAATGTTGGTCCG
ACTAGCTCTGGTGACGAGGTTGAAGGGCAGTCCGATCCTGTCGATCCAAAGTCAATAAGAGATACAGACAATTTG
CCAAATGTATCCGATCTCCATATATCGAAAGATGGATCTTCTGGCCCAAGTGATATCTCAAGGGCCGAAGATGAA
TCGCACATAGGCACCCGTGACAGAAATCTTGTATCGAGTCAGGATTCAGCACGATGGACTGATCGTGAAGTTGTC
GAGGATGACAGCGAGTCCGGCTTCGAAGTGAAGACCAACGCTGGTTTCCGTCACATATAG
Gene >Pro_DTO377G3_2|g6074.t1
ATGCTGATCACTGCGCGCACCTATTCGGCCTCCCAGACCCCAGACCAAGGTGCAGCACAGCCTAGCAATCAAAGG
TCGCGTTTTCATACCTTCTCCGGCTGGGAAACAATTCCGGTGGATACAAAGGAACCGACCGACATGTTGTTAATC
CATCAAGTTGGTAGTGTCCGTGTTGGGGAAGTCGTTAGGTGAGTCGTTCTTGCTTCTCCAGTCCGAAGTCCTTCT
GGATTGCTAATAGTAAACCGACCATCAGATACACGGTTACGTACACTCCGGCGGCCGACCCGATCCTGCCCATCC
CTTCAAATCTCTACGTGAGGGTGAAGAACACATCTGCCATCCCACTGCGCGCCGCATACCTCCATGGCCCGTACA
CGCTATACGCCGCGTGCTATCCCACAAAGTTCGACCCCAACACCAAATATGAGCGACAGGATCTGGAGGGTACAC
CGCAGTTTGAGCCCTACCTTAAGGCCGGAGGTGGTTGGGACGCCGTCATCAAGGTGCCGGCTAACCTCCAGGAAG
CACACGACTTTGGCTCTCCGGGTCAAGGTGGACCGGCAAGTGGACATAGCGTTAGCTGGATTGTTGAGATTCAAT
CGCAGGTGATATTCTCAAGTAGTGCAGCGGTGCATTTTGAGCTTCTTGTGGGTCGTGATGAAAAGTCGCTGGCAT
ATTCCTCGGGCGGTACATGGAGTAGTGGAAATAGCTCTCCAGGGCCTCCGGCAAAGTTACAAGACCATTGGCTGC
CTGGAACTAGAGGTAGTCAGGTGCTTGCCTCGAAAGGCGTGTACTCAAAATCAATCGCTCTTCAAGTTGACGATA
CAACTAGTCTATGGAGCAGTCCGCCATTCCCCTCAGCGAAGCCTGCTTCCAAAAGCGTTGAACGGAAGAGTCATG
ACTCGCAACCCGTGTGTGATAATCCAGTACCGGAGGAGTCTACGGAAGCTCCGATGAAAAGCGCCAAAAAGAAGA
AGGTGCATCTCGTGTTACTGACACATGGGTTGCACAGCAACCTCGGTGCAGACATGCTCTATTTGAAGGAGAGCA
TTGACACAGGCATGAGAAATTCCAAGAAGAATAAACGTCAAGCCAGAGATCCCCATGCTAGCCCTGTTGTAGACC
GAGAAAACCCGACAAGGTATGGAATTCCTTTCTGAACGTTTAGGTGTCTCAAAATTCTAATCCCGAATTTTCTCA
GCAGTAAATCCAGTCATACTGAAGAGCAAAATAGCCAGTCTGGTGATAACTCCGACGATGACGATGAAGAGCAAG
TCATTGTTAGAGGGTTCTCTGGCAATGCTGTTCGGACTGAGCGTGGGATTCAATACCTCGGCAAACGGCTGGCCA
AATATGTCCTGCTTCTCACATATCCCGATCAACCCTATTTCCCTCTCAGAGGCTCAAAGCCGAGCCCATTTGCCC
GGCCTTTTAGTGCTCGCAAGGAGCGAGCTGAACCATTTTCTCATTCGGCTGAATCAACCCCTCAAGAAAATGCCC
ATGAATTTCAAGATGAAGACCATGCTTACCAGATTACAAGCATTAGTTTCATTGCCCATTCTCTTGGCGGGCTGA
TTCAGACATATGCAATCGCATATATCCAGAAGCACTCGCCTCAGTTCTTTGAGCAAATCAGACCCGTTAACTTTA
TTGCCCTTGCAACCCCTTTTCTTGGTCTCAGCAATGAGAATCCAATGTATGTTCGATTTGCATTGGATCTAGGTC
TAGTTGGTCGTACCGGCCAAGATCTCGGGTTGAGTTGGACGGCACCGAAAGTTCGAAGTGGCTGGGGTGCCATTA
TTGCTGGAAGAGGAGAGTCTGCAAAAGACCCCGGCCATTCAGATCCTGGCTCCAAGCCACTTCTTCGGATTCTTC
CTTGTGGTCCTGCCTACGAGGTTCTTAAGAAATTCCAGCACCGCACAGTCTATTCGAATGTGGTGAATGATGGGA
TTGTTCCTTTGCGGACGTCTTCTCTTTTGTTCTTGGACTGGAAAGGTTTGGATCGAGTTGAAAAAGCGAGGAGGG
ACAATGGACTTGTTGGAACCATGGCCGAATGGGGGTGGGCAGAGTTGACAGGCGCCAACTCGAAATCCCCGCGAC
TTGCTCGCCACGATGGAGAGTTGCCTTTGAATCTCCCAATGGAGGCCGGTCATCATCATGCATATTCTGCGACCA
AGGTTCCCCCAAGGCCCAAAGACGATGTCTCTGACGAAGATACAATCTCCCCGAGGCCGGCACAATTCCTGGCAC
CATCCAGTCATGTGTCCAGCAACAAAGTTTCAGAGGAAGGTGTTCTGAAAGAAAACATCCCTGGAAATACCTCTC
ACAGTCCCATGGACAGCTTTTTTTCTCTGTTTCGCCCAACTCAGAACAAGAATCCCCCCAATAGCAAGAATGCTA
GAATTTATAAGCGTAGCCAGACCCTGAGCACTTTTGAGACTGGCGACAGCGATAGCACAATGCCCATTAATCATG
ACCATGACCACGAAGGAATGCACACCCCTCCAAAGACAACATTTTTCGAGTGTGCTGGAGACTTGTTGATGCCGC
CTTTACCACCCGCGGAATTCATTTCAGACCCTGCCTCACGACCCCGGACAATCTTCCACGACCGCATCTACCACC
CAGAGGATATACCACCCCCTTTACCGGTAAAACGACGCATATTGGCATTTGGTTCGCCACAGGGCAAGCAATCAA
ACTCTCAGAATCCGCCTGCAGATAAAGAAAGCGGCCTCAAGGTCGAAGAAAAAATCGCGAGAGCCTATCACCGTG
ATCTGACTTGGCGTAAGGTTCTTGTCCGACTTGAGCCTGATGCCCACAATAACATTATTGTGCGGCGCATGTTCA
CCAATGCCTATGGCTGGCCTGTTGTGAAGCACTTGGTTGATACACACTTCAGCCACACTCTCACTGCGGAAACCG
ACGATTCTCTGAAGCAAAATATGGAGATGGCCAAGTCTCCAAATGTTGGTCCGACTAGCTCTGGTGACGAGGTTG
AAGGGCAGTCCGATCCTGTCGATCCAAAGTCAATAAGAGATACAGACAATTTGCCAAATGTATCCGATCTCCATA
TATCGAAAGATGGATCTTCTGGCCCAAGTGATATCTCAAGGGCCGAAGATGAATCGCACATAGGCACCCGTGACA
GAAATCTTGTATCGAGTCAGGATTCAGCACGATGGACTGATCGTGAAGTTGTCGAGGATGACAGCGAGTCCGGCT
TCGAAGTGAAGACCAACGCTGGTTTCCGTCACATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail