Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6068.t1
Gene name
Locationscaffold_15:526941..530013
Strand-
Gene length (bp)3072
Transcript length (bp)2778
Coding sequence length (bp)2778
Protein length (aa) 926

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 4.7E-200 169 886

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 174 191 17
2 198 220 22
3 303 320 17
4 327 349 22
5 369 391 22
6 403 425 22
7 438 460 22
8 607 626 19
9 636 658 22
10 671 693 22
11 717 739 22
12 785 807 22
13 830 852 22
14 873 892 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6068.t1
MSGAPLLRSSPVLGAPSYGALRDPDGSEEDTPVSRGPKVRGGLHRASFGDGIGSSSNVPGSTPRRSHSFVRQRNS
LYAERNRRPSSAASDVGMGPDSKYSFATGLAVPGNPVMQETPASSPYMTSDDENVLDIDDDDSKSSDEDPPDNSP
YAQVRASVPATDDFSLSINTPRMWILSLLFSLTGSAANLFFSLRYPSVAITPIIALVLVHPLGKFWDLIFRQTGD
PLEFFENGTLHHRESLSGDIEAPPVPLASRVRLWFAQGRWNEKEHACVYISSNVSFGFAFATDVIVEQHKFYNQD
VPIIYQLLLIISTQVLGYAFAGLTRRFLVRPSAMIWPGTLMSTAMFSTMHKSVNKKANGWSISRYKFFVVVWAGA
FLWYFVPGLLMPALSYFNVITWLAPKNVVISNLFGVASGLGMFPLTFDWAQIAYIGSPLLTPWWAAANIVTGLVV
VIWIAAPILYYKNVLFSAYMPIVSTAVFDNSGRPYNVSRILTTDFLFDEKAYQDYSPVYLPITYVLSYGVQFAAL
TSLVSHTICWYGKDIWQQTRKAFEEKRQVPDMETYQPLRGSNDAPRQSYEIPRTSSREASQDIPLGGEDVHCRLM
RRYKDAPLMWYLVVFVSMLVIAIFTVEYYPTHLPWYGLLLALGITSVFFIPVGIIMAVTNQHSSLYLICQLLCGI
VFPGRPVANMIFVTYSYISSAQGIKFSSDLKLGHYMKIPPRILFGVQMMATLVSSLTQIGVLNWMFTFVPGLCTP
EAINGFNCPIARVHFNGSILWGVVGPQRFFGPGGLYRPLVWAFLIGAIAPLGAWLLGRHSKKSFWRMVNFPILFG
SLSWIPPATGLNFSIWALVCFVFNYVIRRRRTAWWEKYAMTLSAALDSGLAFSVVVVFFAFIYPGWVDGFKWWGT
EIYKQGCDWIACPYKPLEPGQRFGQ*
Coding >Pro_DTO377G3_2|g6068.t1
ATGTCGGGCGCCCCTCTTCTTCGTTCATCGCCCGTCCTGGGCGCTCCCTCTTACGGAGCATTGCGAGACCCGGAC
GGCTCAGAAGAGGACACACCCGTTTCGCGTGGGCCGAAAGTTCGTGGGGGGTTACACCGCGCGAGCTTCGGAGAT
GGCATCGGAAGTTCTTCCAACGTACCAGGGTCTACTCCGAGACGATCACATTCCTTTGTCAGACAACGAAACAGC
TTATATGCAGAGAGAAATCGTCGGCCTTCCTCCGCCGCGTCCGATGTGGGAATGGGTCCTGATTCGAAATACTCG
TTCGCTACTGGATTGGCTGTACCGGGTAACCCGGTGATGCAGGAGACTCCGGCGTCTTCACCATATATGACAAGT
GATGATGAAAATGTCCTCGACATTGATGATGATGATTCAAAATCCTCGGATGAGGATCCTCCAGACAATTCGCCG
TATGCCCAAGTTCGGGCTTCCGTTCCGGCGACAGATGATTTCTCTCTTTCTATTAACACACCTCGAATGTGGATT
CTTTCGTTGTTATTCTCTTTGACGGGGTCTGCCGCCAATCTTTTCTTTTCCTTGCGCTATCCCAGTGTTGCCATT
ACACCAATCATTGCTCTTGTTCTAGTCCATCCACTGGGCAAATTTTGGGATTTAATTTTCAGACAAACAGGTGAT
CCGCTCGAGTTTTTTGAAAACGGAACCCTTCACCACCGGGAATCACTCTCCGGTGATATCGAGGCCCCTCCTGTT
CCATTGGCGTCTCGAGTCAGACTTTGGTTTGCCCAGGGCCGTTGGAACGAAAAGGAGCATGCTTGCGTTTACATC
AGCAGCAATGTTTCCTTTGGGTTTGCTTTCGCGACTGATGTTATTGTTGAGCAACATAAATTTTACAACCAGGAT
GTTCCAATTATATATCAGCTGCTGCTCATAATTTCCACTCAAGTTTTGGGATATGCATTCGCGGGTCTAACTCGA
CGATTCCTCGTGCGGCCATCGGCTATGATCTGGCCGGGGACCCTGATGTCCACTGCAATGTTCTCTACAATGCAC
AAGTCTGTCAACAAAAAGGCAAATGGGTGGAGTATCTCCCGATATAAGTTCTTCGTCGTTGTGTGGGCAGGGGCC
TTTCTCTGGTATTTTGTCCCGGGACTGTTGATGCCTGCTCTGAGTTATTTTAATGTGATCACTTGGTTGGCACCC
AAAAATGTGGTGATTTCGAATTTGTTTGGTGTTGCCTCTGGTCTCGGAATGTTTCCCTTGACCTTCGATTGGGCT
CAGATTGCCTATATTGGCTCACCGTTACTCACGCCCTGGTGGGCTGCAGCTAATATTGTCACGGGACTGGTGGTT
GTCATCTGGATAGCCGCCCCAATACTTTATTATAAAAATGTGCTTTTCTCTGCATATATGCCCATAGTTTCAACA
GCTGTGTTCGACAATTCCGGGCGACCATACAACGTGAGCCGAATATTGACCACGGATTTTTTGTTTGATGAAAAG
GCCTATCAAGATTACTCCCCAGTTTATCTCCCAATCACCTACGTGCTGTCTTACGGTGTTCAGTTTGCTGCTTTG
ACATCCCTTGTCTCTCACACCATTTGCTGGTATGGCAAGGACATTTGGCAACAGACTAGGAAGGCCTTTGAGGAA
AAACGGCAAGTGCCAGACATGGAGACGTACCAGCCCCTTCGTGGAAGCAATGATGCTCCCCGACAGAGTTATGAA
ATCCCAAGGACTAGCTCACGTGAAGCGAGCCAGGACATTCCATTGGGAGGGGAAGATGTTCATTGTCGCTTGATG
AGGCGCTATAAGGACGCTCCCCTCATGTGGTATCTTGTTGTGTTCGTTTCTATGCTTGTCATTGCCATCTTCACG
GTGGAATATTACCCAACACATTTACCTTGGTATGGCCTACTCCTGGCTCTTGGTATTACTTCTGTGTTTTTCATC
CCAGTGGGTATCATCATGGCTGTCACCAATCAACATAGCAGCCTCTATCTGATCTGCCAACTCCTTTGCGGTATT
GTATTCCCGGGAAGGCCTGTAGCGAACATGATTTTCGTGACCTACTCATATATCAGCTCTGCACAAGGGATCAAA
TTTTCCTCGGACCTCAAGCTCGGCCATTACATGAAGATCCCACCACGAATTCTGTTTGGCGTGCAGATGATGGCG
ACTTTAGTCTCGAGTCTGACCCAAATTGGTGTGCTGAACTGGATGTTCACTTTTGTCCCGGGGCTTTGCACCCCA
GAGGCTATCAATGGTTTCAACTGCCCCATTGCTCGAGTCCATTTCAACGGCAGCATTCTCTGGGGAGTCGTTGGC
CCGCAGCGCTTCTTTGGCCCAGGAGGGCTATACCGTCCGCTTGTCTGGGCCTTTTTGATAGGAGCCATCGCCCCT
CTCGGAGCGTGGCTTCTGGGAAGACACAGCAAGAAGAGTTTCTGGCGTATGGTCAACTTCCCTATCTTGTTTGGC
AGTCTGAGCTGGATCCCACCTGCAACCGGGCTCAACTTTTCCATCTGGGCCCTTGTATGTTTTGTGTTCAATTAT
GTGATCCGGCGAAGGAGGACCGCATGGTGGGAAAAATATGCAATGACATTGTCGGCCGCATTGGATTCCGGGTTG
GCATTCTCAGTGGTCGTTGTCTTCTTCGCCTTCATTTACCCGGGATGGGTCGATGGTTTCAAATGGTGGGGGACG
GAGATTTATAAACAGGGCTGTGATTGGATTGCTTGTCCATACAAACCACTGGAACCGGGTCAACGATTCGGTCAG
TAG
Transcript >Pro_DTO377G3_2|g6068.t1
ATGTCGGGCGCCCCTCTTCTTCGTTCATCGCCCGTCCTGGGCGCTCCCTCTTACGGAGCATTGCGAGACCCGGAC
GGCTCAGAAGAGGACACACCCGTTTCGCGTGGGCCGAAAGTTCGTGGGGGGTTACACCGCGCGAGCTTCGGAGAT
GGCATCGGAAGTTCTTCCAACGTACCAGGGTCTACTCCGAGACGATCACATTCCTTTGTCAGACAACGAAACAGC
TTATATGCAGAGAGAAATCGTCGGCCTTCCTCCGCCGCGTCCGATGTGGGAATGGGTCCTGATTCGAAATACTCG
TTCGCTACTGGATTGGCTGTACCGGGTAACCCGGTGATGCAGGAGACTCCGGCGTCTTCACCATATATGACAAGT
GATGATGAAAATGTCCTCGACATTGATGATGATGATTCAAAATCCTCGGATGAGGATCCTCCAGACAATTCGCCG
TATGCCCAAGTTCGGGCTTCCGTTCCGGCGACAGATGATTTCTCTCTTTCTATTAACACACCTCGAATGTGGATT
CTTTCGTTGTTATTCTCTTTGACGGGGTCTGCCGCCAATCTTTTCTTTTCCTTGCGCTATCCCAGTGTTGCCATT
ACACCAATCATTGCTCTTGTTCTAGTCCATCCACTGGGCAAATTTTGGGATTTAATTTTCAGACAAACAGGTGAT
CCGCTCGAGTTTTTTGAAAACGGAACCCTTCACCACCGGGAATCACTCTCCGGTGATATCGAGGCCCCTCCTGTT
CCATTGGCGTCTCGAGTCAGACTTTGGTTTGCCCAGGGCCGTTGGAACGAAAAGGAGCATGCTTGCGTTTACATC
AGCAGCAATGTTTCCTTTGGGTTTGCTTTCGCGACTGATGTTATTGTTGAGCAACATAAATTTTACAACCAGGAT
GTTCCAATTATATATCAGCTGCTGCTCATAATTTCCACTCAAGTTTTGGGATATGCATTCGCGGGTCTAACTCGA
CGATTCCTCGTGCGGCCATCGGCTATGATCTGGCCGGGGACCCTGATGTCCACTGCAATGTTCTCTACAATGCAC
AAGTCTGTCAACAAAAAGGCAAATGGGTGGAGTATCTCCCGATATAAGTTCTTCGTCGTTGTGTGGGCAGGGGCC
TTTCTCTGGTATTTTGTCCCGGGACTGTTGATGCCTGCTCTGAGTTATTTTAATGTGATCACTTGGTTGGCACCC
AAAAATGTGGTGATTTCGAATTTGTTTGGTGTTGCCTCTGGTCTCGGAATGTTTCCCTTGACCTTCGATTGGGCT
CAGATTGCCTATATTGGCTCACCGTTACTCACGCCCTGGTGGGCTGCAGCTAATATTGTCACGGGACTGGTGGTT
GTCATCTGGATAGCCGCCCCAATACTTTATTATAAAAATGTGCTTTTCTCTGCATATATGCCCATAGTTTCAACA
GCTGTGTTCGACAATTCCGGGCGACCATACAACGTGAGCCGAATATTGACCACGGATTTTTTGTTTGATGAAAAG
GCCTATCAAGATTACTCCCCAGTTTATCTCCCAATCACCTACGTGCTGTCTTACGGTGTTCAGTTTGCTGCTTTG
ACATCCCTTGTCTCTCACACCATTTGCTGGTATGGCAAGGACATTTGGCAACAGACTAGGAAGGCCTTTGAGGAA
AAACGGCAAGTGCCAGACATGGAGACGTACCAGCCCCTTCGTGGAAGCAATGATGCTCCCCGACAGAGTTATGAA
ATCCCAAGGACTAGCTCACGTGAAGCGAGCCAGGACATTCCATTGGGAGGGGAAGATGTTCATTGTCGCTTGATG
AGGCGCTATAAGGACGCTCCCCTCATGTGGTATCTTGTTGTGTTCGTTTCTATGCTTGTCATTGCCATCTTCACG
GTGGAATATTACCCAACACATTTACCTTGGTATGGCCTACTCCTGGCTCTTGGTATTACTTCTGTGTTTTTCATC
CCAGTGGGTATCATCATGGCTGTCACCAATCAACATAGCAGCCTCTATCTGATCTGCCAACTCCTTTGCGGTATT
GTATTCCCGGGAAGGCCTGTAGCGAACATGATTTTCGTGACCTACTCATATATCAGCTCTGCACAAGGGATCAAA
TTTTCCTCGGACCTCAAGCTCGGCCATTACATGAAGATCCCACCACGAATTCTGTTTGGCGTGCAGATGATGGCG
ACTTTAGTCTCGAGTCTGACCCAAATTGGTGTGCTGAACTGGATGTTCACTTTTGTCCCGGGGCTTTGCACCCCA
GAGGCTATCAATGGTTTCAACTGCCCCATTGCTCGAGTCCATTTCAACGGCAGCATTCTCTGGGGAGTCGTTGGC
CCGCAGCGCTTCTTTGGCCCAGGAGGGCTATACCGTCCGCTTGTCTGGGCCTTTTTGATAGGAGCCATCGCCCCT
CTCGGAGCGTGGCTTCTGGGAAGACACAGCAAGAAGAGTTTCTGGCGTATGGTCAACTTCCCTATCTTGTTTGGC
AGTCTGAGCTGGATCCCACCTGCAACCGGGCTCAACTTTTCCATCTGGGCCCTTGTATGTTTTGTGTTCAATTAT
GTGATCCGGCGAAGGAGGACCGCATGGTGGGAAAAATATGCAATGACATTGTCGGCCGCATTGGATTCCGGGTTG
GCATTCTCAGTGGTCGTTGTCTTCTTCGCCTTCATTTACCCGGGATGGGTCGATGGTTTCAAATGGTGGGGGACG
GAGATTTATAAACAGGGCTGTGATTGGATTGCTTGTCCATACAAACCACTGGAACCGGGTCAACGATTCGGTCAG
TAG
Gene >Pro_DTO377G3_2|g6068.t1
ATGTCGGGCGCCCCTCTTCTTCGTTCATCGCCCGTCCTGGGCGCTCCCTCTTACGGAGCATTGCGAGACCCGGAC
GGCTCAGAAGAGGACACACCCGTTTCGCGTGGGCCGAAAGTTCGTGGGGGGTTACACCGCGCGAGCTTCGGAGAT
GGCATCGGAAGTTCTTCCAACGTACCAGGGTCTACTCCGAGACGATCACATTCCTTTGTCAGACAACGAAACAGC
TTATATGCAGAGAGAAATCGTCGGCCTTCCTCCGCCGCGTCCGATGTGGGAATGGGTCCTGATTCGAAATACTCG
TTCGCTACTGGATTGGCTGTACCGGGTAACCCGGTGATGCAGGAGACTCCGGCGTCTTCACCATATATGACAAGT
GATGATGAAAATGTCCTCGACATTGATGATGATGATTCAAAATCCTCGGATGAGGATCCTCCAGACAATTCGCCG
TATGCCCAAGTTCGGGCTTCCGTTCCGGCGACAGATGATTTCTCTCTTTCTATTAACAGTAGGCTTTCTTTCTGG
TGCTTTTTCTCCTTATATCTAATGATCTCTAGCACCTCGAATGTGGATTCTTTCGTTGTTATTCTCTTTGACGGG
GTCTGCCGCCAATCTTTTCTTTTCCTTGCGCTATCCCAGTGTTGCCATTACACCAATCATTGCTCTTGTTCTAGT
CCATCCACTGGGCAAATTTTGGGATTTAATTTTCAGACAAACAGGTGATCCGCTCGAGTTTTTTGAAAACGGAAC
CCTTCACCACCGGGAATCACTCTCCGGTGATATCGAGGCCCCTCCTGTTCCATTGGCGTCTCGAGTCAGACTTTG
GTTTGCCCAGGGCCGTTGGAACGAAAAGGAGCATGCTTGCGTTTACATCAGCAGCAATGTTTCCTTTGGGTTTGC
TTTCGCGACTGATGTTAGTAGACCAACGAAATACTCATGACGAAGCTGACCCAAGACAGGTTATTGTTGAGCAAC
ATAAATTTTACAACCAGGATGTTCCAATTATATATCAGCTGCTGCTCATAATTTCCACTCAAGTTTTGGGATATG
CATTCGCGGGTCTAACTCGACGATTCCTCGTGCGGCCATCGGCTATGATCTGGCCGGGGACCCTGATGTCCACTG
CAATGTTCTCTACAATGCACAAGTCTGTCAACAAAAAGGCAAATGGGTGGAGTATCTCCCGATATAAGTTCTTCG
TCGTTGTGTGGGCAGGGGCCTTTCTCTGGTATTTTGTCCCGGGACTGTTGATGCCTGCTCTGAGTTATTTTAATG
TGATCACTTGGTTGGCACCCAAAAATGTGGTGATTTCGAATTTGGTAAGACATTCAGGTCCTCTTTTTAAGCTGC
TATAGCTAACTCTCTTTAGTTTGGTGTTGCCTCTGGTCTCGGAATGTTTCCCTTGACCTTCGATTGGGCTCAGAT
TGCCTATATTGGCTCACCGTTACTCACGCCCTGGTGGGCTGCAGCTAATATTGTCACGGGACTGGTGGTTGTCAT
CTGGATAGCCGCCCCAATACTTTGTAAGGCCCCCCCGTCTTATCTAATTTGACTCTGCTGATCAAATGAAGATTA
TAAAAATGTGCTTTTCTCTGCATATATGCCCATAGTTTCAACAGCTGTGTTCGACAATTCCGGGCGACCATACAA
CGTGAGCCGAATATTGACCACGGATTTTTTGTTTGATGAAAAGGCCTATCAAGATTACTCCCCAGTTTATCTCCC
AATCACCTACGTGCTGTCTTACGGTGTTCAGTTTGCTGCTTTGACATCCCTTGTCTCTCACACCATTTGCTGGTA
TGGCAAGGACATTTGGCAACAGACTAGGAAGGCCTTTGAGGAAAAACGGCAAGTGCCAGACATGGAGACGTACCA
GCCCCTTCGTGGAAGCAATGATGCTCCCCGACAGAGTTATGAAATCCCAAGGACTAGCTCACGTGAAGCGAGCCA
GGACATTCCATTGGGAGGGGAAGATGTTCATTGTCGCTTGATGAGGCGCTATAAGGACGCTCCCCTCATGTGGTA
TCTTGTTGTGTTCGTTTCTATGCTTGTCATTGCCATCTTCACGGTGGAATAGTACGTTTTCAATCCCCCTTGACC
TTCGATAGCAACTAACCTGCACAAAAGTTACCCAACACATTTACCTTGGTATGGCCTACTCCTGGCTCTTGGTAT
TACTTCTGTGTTTTTCATCCCAGTGGGTATCATCATGGCTGTCACCAATCAACATAGCAGCCTCTATCTGATCTG
CCAACTCCTTTGCGGTATTGTATTCCCGGGAAGGCCTGTAGCGAACATGATTTTCGTGACCTACTCATATATCAG
CTCTGCACAAGGGATCAAATTTTCCTCGGACCTCAAGCTCGGCCATTACATGAAGATCCCACCACGAATTCTGTT
TGGCGTGCAGATGATGGCGACTTTAGTCTCGAGTCTGACCCAAATTGGTGTGCTGAACTGGATGTTCACTTTTGT
CCCGGGGCTTTGCACCCCAGAGGCTATCAATGGTTTCAACTGCCCCATTGCTCGAGTCCATTTCAACGGCAGCAT
TCTCTGGGGAGTCGTTGGCCCGCAGCGCTTCTTTGGCCCAGGAGGGCTATACCGTCCGCTTGTCTGGGCCTTTTT
GATAGGAGCCATCGCCCCTCTCGGAGCGTGGCTTCTGGGAAGACACAGCAAGAAGAGTTTCTGGCGTATGGTCAA
CTTCCCTATCTTGTTTGGCAGTCTGAGCTGGATCCCACCTGCAACCGGGCTCAACTTTTCCATCTGGGCCCTTGT
ATGTTTTGTGTTCAATTATGTGATCCGGCGAAGGAGGACCGCATGGTGGGAAAAATATGCAATGACATTGTCGGC
CGCATTGGATTCCGGGTTGGCATTCTCAGTGGTCGTTGTCTTCTTCGCCTTCATTTACCCGGGATGGGTCGATGG
TTTCAAATGGTGGGGGACGGAGATTTATAAACAGGTACGTCCTTGGTCTTCTGGTTGTTTTTGGTCCCTACTAAT
TGTGTCAAGGGCTGTGATTGGATTGCTTGTCCATACAAACCACTGGAACCGGGTCAACGATTCGGTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail