Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6062.t1
Gene name
Locationscaffold_15:504969..506008
Strand+
Gene length (bp)1039
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 9.5E-05 83 153
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 5.5E-33 180 303

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 117 139 22
2 174 196 22
3 216 238 22
4 277 299 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6062.t1
MPSHLLSKPDDIDTRSMISLQELDPSPVHDVLDIESGEFFPRATSPTQHTAGISMPKLGLSGHSWDSWLTGIQKY
STYPPTAFFILHLANTSLIPLVTRSVPASESYLLLTRPVYQAPGLEHLVLTLPIIAHIASGIALRNIRAARRARL
YGAETRAQRSTLYFWPRMSLQARTGYFIVPLVAFHALVNRVTPLIVEGGSSGVGLGYIAHGFTRNPMFWNVFYFF
FVTASAWHFVGGWATWMGWRVTTARKERSHKGSLDGYRGPTETKSKRQRKMWWVVNGIAAAGAALWLAGSLGIVG
RAGEGAGWEAKGWNEMYSQVPIVGKWL*
Coding >Pro_DTO377G3_2|g6062.t1
ATGCCGTCCCACCTGCTCTCCAAACCGGACGACATCGACACCAGATCTATGATCTCCCTGCAAGAATTAGACCCA
TCACCTGTCCATGATGTCCTGGATATTGAAAGCGGCGAATTCTTCCCTAGGGCCACCTCTCCGACGCAACATACA
GCTGGTATTTCAATGCCAAAACTAGGCCTGAGCGGCCATAGCTGGGATTCATGGCTGACTGGTATCCAAAAATAC
TCAACCTATCCACCTACGGCTTTCTTCATCCTACATCTCGCGAACACCTCTCTTATACCACTCGTTACTCGCTCC
GTGCCCGCGAGCGAATCCTATCTTTTGCTCACACGACCCGTATACCAAGCACCCGGACTAGAGCATCTCGTCTTA
ACACTTCCTATAATTGCGCATATTGCCTCCGGAATTGCTCTCCGCAACATTCGTGCTGCGCGTAGAGCACGTCTG
TACGGCGCCGAGACTCGCGCCCAGCGAAGCACGTTATATTTCTGGCCGCGGATGTCATTGCAAGCACGCACTGGA
TACTTTATCGTGCCGCTGGTTGCATTCCATGCACTCGTCAACCGTGTTACACCATTGATCGTCGAAGGAGGAAGC
TCTGGCGTAGGACTTGGATATATTGCCCATGGGTTTACTCGGAATCCTATGTTCTGGAATGTCTTTTATTTCTTT
TTTGTGACCGCCAGTGCGTGGCACTTTGTTGGTGGCTGGGCGACCTGGATGGGCTGGAGAGTGACCACAGCGCGC
AAGGAGCGTAGTCACAAAGGCTCGTTGGATGGCTACCGTGGACCCACGGAAACAAAGTCGAAGAGGCAGCGCAAG
ATGTGGTGGGTTGTCAATGGAATTGCCGCGGCTGGCGCGGCTCTTTGGCTTGCAGGTTCTCTCGGTATTGTTGGA
CGTGCTGGCGAAGGTGCTGGTTGGGAGGCCAAGGGGTGGAATGAGATGTATAGTCAGGTCCCGATCGTTGGGAAG
TGGCTGTGA
Transcript >Pro_DTO377G3_2|g6062.t1
ATGCCGTCCCACCTGCTCTCCAAACCGGACGACATCGACACCAGATCTATGATCTCCCTGCAAGAATTAGACCCA
TCACCTGTCCATGATGTCCTGGATATTGAAAGCGGCGAATTCTTCCCTAGGGCCACCTCTCCGACGCAACATACA
GCTGGTATTTCAATGCCAAAACTAGGCCTGAGCGGCCATAGCTGGGATTCATGGCTGACTGGTATCCAAAAATAC
TCAACCTATCCACCTACGGCTTTCTTCATCCTACATCTCGCGAACACCTCTCTTATACCACTCGTTACTCGCTCC
GTGCCCGCGAGCGAATCCTATCTTTTGCTCACACGACCCGTATACCAAGCACCCGGACTAGAGCATCTCGTCTTA
ACACTTCCTATAATTGCGCATATTGCCTCCGGAATTGCTCTCCGCAACATTCGTGCTGCGCGTAGAGCACGTCTG
TACGGCGCCGAGACTCGCGCCCAGCGAAGCACGTTATATTTCTGGCCGCGGATGTCATTGCAAGCACGCACTGGA
TACTTTATCGTGCCGCTGGTTGCATTCCATGCACTCGTCAACCGTGTTACACCATTGATCGTCGAAGGAGGAAGC
TCTGGCGTAGGACTTGGATATATTGCCCATGGGTTTACTCGGAATCCTATGTTCTGGAATGTCTTTTATTTCTTT
TTTGTGACCGCCAGTGCGTGGCACTTTGTTGGTGGCTGGGCGACCTGGATGGGCTGGAGAGTGACCACAGCGCGC
AAGGAGCGTAGTCACAAAGGCTCGTTGGATGGCTACCGTGGACCCACGGAAACAAAGTCGAAGAGGCAGCGCAAG
ATGTGGTGGGTTGTCAATGGAATTGCCGCGGCTGGCGCGGCTCTTTGGCTTGCAGGTTCTCTCGGTATTGTTGGA
CGTGCTGGCGAAGGTGCTGGTTGGGAGGCCAAGGGGTGGAATGAGATGTATAGTCAGGTCCCGATCGTTGGGAAG
TGGCTGTGA
Gene >Pro_DTO377G3_2|g6062.t1
ATGCCGTCCCACCTGCTCTCCAAACCGGACGACATCGACACCAGATCTATGATCTCCCTGCAAGAATTAGACCCA
TCACCTGTCCATGATGTCCTGGATATTGAAAGCGGCGAATTCTTCCCTAGGGCCACCTCTCCGACGCAACATACA
GCTGGTATTTCAATGCCAAAACTAGGCCTGAGCGGCCATAGCTGGGATTCATGGCGTACGTCAAGTGACAAAATG
CTGGATCATATATTCTAACTACGATGACCGCTTAGTGACTGGTATCCAAAAATACTCAACCTATCCACCTACGGC
TTTCTTCATCCTACATCTCGCGAACACCTCTCTTATACCACTCGTTACTCGCTCCGTGCCCGCGAGCGAATCCTA
TCTTTTGCTCACACGACCCGTATACCAAGCACCCGGACTAGAGCATCTCGTCTTAACACTTCCTATAATTGCGCA
TATTGCCTCCGGAATTGCTCTCCGCAACATTCGTGCTGCGCGTAGAGCACGTCTGTACGGCGCCGAGACTCGCGC
CCAGCGAAGCACGTTATATTTCTGGCCGCGGATGTCATTGCAAGCACGCACTGGATACTTTATCGTGCCGCTGGT
TGCATTCCATGCACTCGTCAACCGTGTTACACCATTGATCGTCGAAGGAGGAAGCTCTGGCGTAGGACTTGGATA
TATTGCCCATGGGTTTACTCGGAATCCTATGTTCTGGAATGTCTTTTATTTCTTTTTTGTGACCGCCAGTGCGTG
GCACTTTGTTGGTGGCTGGGCGACCTGGATGGGCTGGAGAGTGACCACAGCGCGCAAGGAGCGTAGTCACAAAGG
CTCGTTGGATGGCTACCGTGGACCCACGGAAACAAAGTCGAAGAGGCAGCGCAAGATGTGGTGGGTTGTCAATGG
AATTGCCGCGGCTGGCGCGGCTCTTTGGCTTGCAGGTTCTCTCGGTATTGTTGGACGTGCTGGCGAAGGTGCTGG
TTGGGAGGCCAAGGGGTGGAATGAGATGTATAGTCAGGTCCCGATCGTTGGGAAGTGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail