Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g601.t1
Gene name
Locationscaffold_01:1543311..1545236
Strand-
Gene length (bp)1925
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 1.9E-172 16 494

GO

GO Term Description Terminal node
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0044425 membrane part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0044424 intracellular part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0016020 membrane No
GO:0044432 endoplasmic reticulum part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0044444 cytoplasmic part No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 97 119 22
3 129 146 17
4 151 168 17
5 178 200 22
6 221 243 22
7 356 378 22
8 385 404 19
9 414 433 19
10 446 468 22
11 478 500 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g601.t1
MADLYPSLAQCAIVAAAFKVLLFPAYKSTDFEVHRNWLAITHSLPIQEWYYEKSSEWTLDYPPFFAAFEWLMSQA
AVYADPAMLIVKNLGYDSWQTVYFQRSTVILTELVLVYALSRFVKSVPLPNRQAAHVASLSILLSPGLLIIDHIH
FQYNGFMYGILILSIVLARKQSTLLYSGILFAVLLCMKHIYLYLALAYFVYLLRTYCLSLKSVFRPRFGNIFKLG
VGVVGVFAIAFGPFAQWGQLLQLKDRLFPFSRGLCHAYWAPNIWAMYSFADRALISLAPRLGLPVNTTALNSVTR
GLVGDTSFAVLPQITKEYTFILTFLFQLVPLVKVWFNPGCWDTFVGAITLCGYASFLFGWHVHEKAILLIIIPFS
LIALKDRRYFSAFRPLAVAGHVSLFPLLFTASDFPLKTIYTVLWLVLFLFVFDRVAPVPERPRIFLFDRLSLLYL
TISIPLIIYCSLGHQLIFGWDRLEFLPLMFMSSYCALGVVGSWVGFMVVYFTS*
Coding >Pro_DTO377G3_2|g601.t1
ATGGCTGACCTATACCCTTCATTGGCGCAATGCGCCATCGTTGCAGCTGCTTTCAAGGTGCTGCTCTTCCCCGCA
TACAAATCGACCGATTTTGAGGTCCATCGCAATTGGCTTGCCATCACTCATTCTCTCCCCATCCAAGAGTGGTAC
TACGAGAAATCCTCGGAATGGACACTTGATTACCCACCGTTCTTTGCAGCCTTCGAGTGGCTGATGTCACAGGCT
GCTGTATACGCAGACCCTGCGATGCTGATCGTGAAGAACCTTGGCTATGATTCCTGGCAGACCGTCTACTTTCAA
AGATCAACCGTGATTTTGACGGAGTTGGTTCTTGTCTATGCGCTTAGTCGATTCGTCAAGTCGGTTCCTTTGCCA
AACAGGCAGGCTGCGCATGTAGCCAGTCTCTCTATCCTACTATCCCCCGGTCTCCTCATCATTGATCATATCCAC
TTCCAATACAATGGTTTCATGTATGGAATCCTGATCCTATCAATCGTCCTGGCTCGCAAGCAATCGACTCTTCTC
TACAGCGGTATCCTCTTTGCTGTGCTGCTATGCATGAAGCACATATACCTATACCTTGCCCTCGCCTACTTCGTC
TATCTACTGCGCACCTATTGCCTTAGTCTCAAATCGGTTTTCCGGCCCCGATTCGGTAATATTTTCAAACTTGGA
GTTGGTGTGGTGGGTGTCTTTGCAATTGCCTTTGGGCCATTTGCACAATGGGGACAATTGCTGCAGCTCAAGGAT
AGGCTGTTTCCGTTTTCGAGAGGACTGTGTCATGCGTACTGGGCACCGAATATCTGGGCGATGTACTCCTTCGCT
GATCGAGCCTTGATTTCCCTTGCTCCACGGCTAGGGCTGCCCGTGAACACTACTGCTCTGAATAGTGTCACACGA
GGACTGGTGGGAGACACCTCTTTTGCCGTCCTTCCGCAGATTACAAAGGAATATACCTTCATATTAACCTTCTTG
TTCCAACTGGTTCCTCTCGTCAAGGTCTGGTTCAACCCAGGCTGCTGGGATACCTTTGTCGGTGCGATCACCCTC
TGTGGCTACGCATCATTCCTCTTTGGTTGGCATGTGCATGAGAAAGCTATTCTCCTCATTATCATCCCATTCAGT
CTCATCGCCCTCAAGGACCGTCGCTACTTCAGCGCCTTCCGACCTCTGGCGGTTGCGGGCCATGTTTCGCTCTTC
CCGCTGCTGTTTACAGCATCCGACTTCCCCCTCAAGACTATTTATACGGTCCTGTGGTTGGTGCTGTTCCTTTTC
GTCTTCGACCGAGTCGCACCTGTCCCCGAGCGGCCCCGAATTTTCCTATTCGACCGGCTTTCGCTGCTCTACTTG
ACCATCTCTATTCCTCTGATTATCTACTGCTCCCTGGGGCACCAATTGATATTCGGATGGGACCGGCTAGAGTTC
CTGCCATTGATGTTCATGAGCAGTTATTGTGCCCTCGGCGTCGTCGGAAGCTGGGTTGGGTTCATGGTGGTTTAT
TTTACCTCTTAG
Transcript >Pro_DTO377G3_2|g601.t1
ATGGCTGACCTATACCCTTCATTGGCGCAATGCGCCATCGTTGCAGCTGCTTTCAAGGTGCTGCTCTTCCCCGCA
TACAAATCGACCGATTTTGAGGTCCATCGCAATTGGCTTGCCATCACTCATTCTCTCCCCATCCAAGAGTGGTAC
TACGAGAAATCCTCGGAATGGACACTTGATTACCCACCGTTCTTTGCAGCCTTCGAGTGGCTGATGTCACAGGCT
GCTGTATACGCAGACCCTGCGATGCTGATCGTGAAGAACCTTGGCTATGATTCCTGGCAGACCGTCTACTTTCAA
AGATCAACCGTGATTTTGACGGAGTTGGTTCTTGTCTATGCGCTTAGTCGATTCGTCAAGTCGGTTCCTTTGCCA
AACAGGCAGGCTGCGCATGTAGCCAGTCTCTCTATCCTACTATCCCCCGGTCTCCTCATCATTGATCATATCCAC
TTCCAATACAATGGTTTCATGTATGGAATCCTGATCCTATCAATCGTCCTGGCTCGCAAGCAATCGACTCTTCTC
TACAGCGGTATCCTCTTTGCTGTGCTGCTATGCATGAAGCACATATACCTATACCTTGCCCTCGCCTACTTCGTC
TATCTACTGCGCACCTATTGCCTTAGTCTCAAATCGGTTTTCCGGCCCCGATTCGGTAATATTTTCAAACTTGGA
GTTGGTGTGGTGGGTGTCTTTGCAATTGCCTTTGGGCCATTTGCACAATGGGGACAATTGCTGCAGCTCAAGGAT
AGGCTGTTTCCGTTTTCGAGAGGACTGTGTCATGCGTACTGGGCACCGAATATCTGGGCGATGTACTCCTTCGCT
GATCGAGCCTTGATTTCCCTTGCTCCACGGCTAGGGCTGCCCGTGAACACTACTGCTCTGAATAGTGTCACACGA
GGACTGGTGGGAGACACCTCTTTTGCCGTCCTTCCGCAGATTACAAAGGAATATACCTTCATATTAACCTTCTTG
TTCCAACTGGTTCCTCTCGTCAAGGTCTGGTTCAACCCAGGCTGCTGGGATACCTTTGTCGGTGCGATCACCCTC
TGTGGCTACGCATCATTCCTCTTTGGTTGGCATGTGCATGAGAAAGCTATTCTCCTCATTATCATCCCATTCAGT
CTCATCGCCCTCAAGGACCGTCGCTACTTCAGCGCCTTCCGACCTCTGGCGGTTGCGGGCCATGTTTCGCTCTTC
CCGCTGCTGTTTACAGCATCCGACTTCCCCCTCAAGACTATTTATACGGTCCTGTGGTTGGTGCTGTTCCTTTTC
GTCTTCGACCGAGTCGCACCTGTCCCCGAGCGGCCCCGAATTTTCCTATTCGACCGGCTTTCGCTGCTCTACTTG
ACCATCTCTATTCCTCTGATTATCTACTGCTCCCTGGGGCACCAATTGATATTCGGATGGGACCGGCTAGAGTTC
CTGCCATTGATGTTCATGAGCAGTTATTGTGCCCTCGGCGTCGTCGGAAGCTGGGTTGGGTTCATGGTGGTTTAT
TTTACCTCTTAG
Gene >Pro_DTO377G3_2|g601.t1
ATGGCTGACCTATACCCTTCATTGGCGCAATGCGCCATCGTTGCAGCTGCTTTCAAGGTGCTGCTCTTCCCCGCA
TAGTGAGTCCGTCCCGCTCGTTTCGCCGGAGAAAAAAGATCGGAAGGAGAGGTGGAAAGATATCGAACAATCACT
ACAAAGAATCTGCAAGGGGGGTTTTAGAGGGACCGGGAATAGGACATTGAGGTTACCAAATGAGCTTTGCTAACA
TGCTTTTCTTTGTGTTGCAGCAAATCGACCGATTTTGAGGTCCATCGCAATTGGCTTGCCATCACTCATTCTCTC
CCCATCCAAGAGTGGTACTACGAGGTATGTTCGGTCGGGCGCATGATTCTAGGCAGGTATAGGATGTTGACTTTG
GGCTTAGAAATCCTCGGAATGGACACTTGATTACCCACCGTTCTTTGCAGCCTTCGAGTGGCTGATGTCACAGGC
TGCTGTATACGCAGACCCTGCGATGCTGATCGTGAAGAACCTTGGCTATGATTCCTGGCAGACCGTCTACTTTCA
AAGATCAACCGTGATTTTGACGGAGTTGGTTCTTGTCTATGCGCTTAGTCGGTATGAGTTGTCGACCCTGACCCT
TTTTTGGCTTTTTTTTTCTGGTGATGCAACATAATTCTGACTGCAGTTCGATAGATTCGTCAAGTCGGTTCCTTT
GCCAAACAGGCAGGCTGCGCATGTAGCCAGTCTCTCTATCCTACTATCCCCCGGTCTCCTCATCATTGATCATAT
CCACTTCCAATACAATGGTTTCATGTATGGAATCCTGATCCTATCAATCGTCCTGGCTCGCAAGCAATCGACTCT
TCTCTACAGCGGTATCCTCTTTGCTGTGCTGCTATGCATGAAGCACATATACCTATACCTTGCCCTCGCCTACTT
CGTCTATCTACTGCGCACCTATTGCCTTAGTCTCAAATCGGTTTTCCGGCCCCGATTCGGTAATATTTTCAAACT
TGGAGTTGGTGTGGTGGGTGTCTTTGCAATTGCCTTTGGGCCATTTGCACAATGGGGACAATTGCTGCAGCTCAA
GGATAGGCTGTTTCCGTTTTCGAGAGGACTGTGTCATGCGTACTGGGCACCGAATATCTGGGCGATGTACTCCTT
CGCTGATCGAGCCTTGATTTCCCGTAAGTAGCCTCTATCTCCCTCGGCGCACACGACATATGAGCGTATCTGACA
ATCTACAGTTGCTCCACGGCTAGGGCTGCCCGTGAACACTACTGCTCTGAATAGTGTCACACGAGGACTGGTGGG
AGACACCTCTTTTGCCGTCCTTCCGCAGATTACAAAGGAATATACCTTCATATTAACCTTCTTGTTCCAACTGGT
ATGTGTCCCTGGTCTTGTCCCTTTGGCCTTCTCTCACAATTGTTTAGGTTCCTCTCGTCAAGGTCTGGTTCAACC
CAGGCTGCTGGGATACCTTTGTCGGTGCGATCACCCTCTGTGGCTACGCATCATTCCTCTTTGGTTGGCATGTGC
ATGAGAAAGCTATTCTCCTCATTATCATCCCATTCAGTCTCATCGCCCTCAAGGACCGTCGCTACTTCAGCGCCT
TCCGACCTCTGGCGGTTGCGGGCCATGTTTCGCTCTTCCCGCTGCTGTTTACAGCATCCGACTTCCCCCTCAAGA
CTATTTATACGGTCCTGTGGTTGGTGCTGTTCCTTTTCGTCTTCGACCGAGTCGCACCTGTCCCCGAGCGGCCCC
GAATTTTCCTATTCGACCGGCTTTCGCTGCTCTACTTGACCATCTCTATTCCTCTGATTATCTACTGCTCCCTGG
GGCACCAATTGATATTCGGATGGGACCGGCTAGAGTTCCTGCCATTGATGTTCATGAGCAGTTATTGTGCCCTCG
GCGTCGTCGGAAGCTGGGTTGGGTTCATGGTGGTTTATTTTACCTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail