Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5979.t1
Gene name
Locationscaffold_15:305577..307654
Strand+
Gene length (bp)2077
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.6E-05 611 635

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 332.68 189.56 475.80
5d_25C Five days - 25 degrees Celsius 425.14 237.52 612.76
7d_25C Seven days - 25 degrees Celsius 374.16 210.21 538.11
10d_25C Ten days - 25 degrees Celsius 493.12 271.26 714.99
7d_15C Seven days - 15 degrees Celsius 553.99 291.81 816.17
7d_30C Seven days - 30 degrees Celsius 339.06 192.00 486.12

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.354042 no
3d_25C 7d_25C 0.707424 no
3d_25C 7d_15C 0.039348 yes
3d_25C 7d_30C 0.961164 no
3d_25C 10d_25C 0.104111 no
5d_25C 7d_25C 0.683213 no
5d_25C 7d_15C 0.344585 no
5d_25C 7d_30C 0.416178 no
5d_25C 10d_25C 0.630147 no
7d_25C 7d_15C 0.133838 no
7d_25C 7d_30C 0.768071 no
7d_25C 10d_25C 0.298591 no
7d_15C 7d_30C 0.047323 yes
7d_15C 10d_25C 0.735102 no
7d_30C 10d_25C 0.134694 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5979.t1
MLMYPRKGLITDPYNPEGIIIQDDQYPPDFYSENALHYDQSRLQSPFQCHPSVQLSPPSSAPPSPTFSSPTFSTS
YPQTSDCQSFGAPSMTPASSYNPSYDIQGSNSPSHYLSQYPQQYYTPMLVQQPLASNQGWDSNLQLLSPARIPYP
GVQKRSSPSASSRSAHAGLPANNYHRRSNSANKPLPTPVQTPLQNSFLATPFQSFDPSSQDGHNAEAESAMRKAI
MDQQKQSPQQMQNDYSLAPSASSMSHNSPVTPQTTLDELDDASKSMTNEYNANGAMSIGVPKLNRTISDIYQDEL
YNPAIMAAPQMSKPMGQNHLNPRNFIADRLQAANQGHLSARSQSPGGRRDRSPFRTSSPFAGDMSNNALQQPQMA
TSVPMGQNAMNGLNGMNMDQTTTGDIKTMSPKDAVLDFQDNDDSMPPLFPPGQADFNLGDALGLRRDTGPMRPME
AFPQYSTPSMAQPQFAFSEPQMHRPQNLLPQGTDFPSLPAVESTESSPPSQMNMSITESIPRPDNTSSDAGTYTC
TYHNCTDRFDSPSRLQRHKREAHRQTTPGGHLVSRDTSLRNSQAGPHKCERINPSTGKACNSIFSRPYDLTRHEH
TIHTAGKQKVRCHICNEDKTFSRNDALTRHMRVVHPEIDWPGKQRRRRD*
Coding >Pro_DTO377G3_2|g5979.t1
ATGCTTATGTACCCACGTAAGGGTCTCATCACCGATCCATACAACCCTGAGGGCATCATCATACAAGACGACCAA
TACCCACCGGATTTCTATTCTGAGAACGCCTTGCACTACGATCAGTCTCGTTTGCAGTCACCGTTCCAGTGCCAC
CCCAGTGTACAGCTCTCCCCGCCATCTTCCGCACCTCCCTCGCCTACTTTCTCCTCTCCGACCTTCTCGACTTCT
TACCCGCAGACGTCTGACTGTCAGTCTTTCGGGGCTCCTTCGATGACCCCAGCGTCTTCATATAACCCGTCATAC
GACATCCAGGGTTCTAATTCACCATCGCACTACCTGTCGCAATATCCTCAGCAATATTATACGCCCATGCTGGTA
CAACAGCCGCTCGCTAGTAACCAGGGTTGGGATAGCAACCTGCAGTTGTTGAGCCCTGCGCGCATCCCATACCCC
GGTGTGCAAAAGCGATCCTCACCCTCGGCATCCTCGCGCTCAGCTCACGCAGGGTTGCCCGCCAACAACTACCAC
CGCCGCTCAAACAGCGCCAACAAGCCGCTACCCACCCCGGTGCAAACCCCTCTCCAGAACTCATTCCTTGCGACT
CCATTCCAAAGTTTCGATCCCTCCTCCCAAGATGGTCACAATGCCGAGGCCGAGTCTGCCATGAGAAAAGCGATC
ATGGACCAACAGAAGCAGTCACCGCAGCAAATGCAGAACGACTACTCCCTGGCTCCATCGGCGTCATCGATGAGC
CATAATTCACCGGTGACTCCGCAGACTACCCTCGATGAACTCGACGATGCATCCAAGTCGATGACCAATGAATAC
AATGCCAATGGTGCCATGTCAATTGGAGTCCCCAAGCTGAACAGAACGATTTCCGATATCTACCAAGACGAATTG
TACAACCCCGCCATCATGGCAGCGCCTCAGATGTCCAAGCCAATGGGACAGAATCACCTCAACCCGCGCAATTTC
ATTGCCGATCGTCTTCAAGCTGCTAACCAAGGACACTTGTCAGCTCGTTCGCAATCGCCTGGCGGCAGACGGGAT
CGCTCACCTTTCCGTACTTCTTCCCCATTCGCCGGTGATATGAGTAACAACGCTCTCCAGCAGCCCCAGATGGCC
ACCAGCGTCCCCATGGGACAGAACGCAATGAATGGGTTGAACGGAATGAACATGGACCAGACCACAACTGGAGAT
ATCAAGACTATGTCCCCCAAGGATGCGGTTTTGGATTTCCAAGACAACGATGATTCCATGCCTCCTCTGTTCCCT
CCGGGTCAGGCTGATTTCAACCTGGGTGATGCGCTTGGCTTGCGCCGCGATACTGGCCCAATGCGACCGATGGAA
GCATTCCCTCAGTATTCGACACCTAGCATGGCCCAGCCACAGTTCGCATTCTCTGAACCTCAGATGCATCGCCCT
CAGAACCTCTTGCCGCAGGGTACCGATTTCCCTTCGCTCCCAGCAGTGGAATCTACCGAGAGCTCGCCTCCAAGT
CAAATGAATATGTCCATTACAGAGAGCATTCCTCGTCCCGACAACACGTCTTCGGATGCGGGCACCTACACTTGC
ACATATCACAACTGCACAGACCGCTTCGACTCTCCCTCTAGACTCCAGCGACATAAGCGCGAGGCGCACCGACAA
ACTACACCGGGCGGCCACCTTGTCAGCCGCGATACCTCGCTCCGCAACTCCCAGGCTGGCCCGCACAAGTGCGAA
CGCATCAACCCGTCTACAGGCAAAGCATGCAATTCTATCTTCTCCCGGCCTTACGATCTTACACGGCACGAGCAT
ACGATTCACACTGCTGGAAAGCAGAAGGTGCGCTGCCACATCTGTAACGAGGACAAGACCTTCAGCCGAAACGAT
GCTTTGACAAGACATATGCGAGTGGTTCATCCCGAGATCGACTGGCCAGGCAAGCAGCGCAGAAGGAGAGACTGA
Transcript >Pro_DTO377G3_2|g5979.t1
ATGCTTATGTACCCACGTAAGGGTCTCATCACCGATCCATACAACCCTGAGGGCATCATCATACAAGACGACCAA
TACCCACCGGATTTCTATTCTGAGAACGCCTTGCACTACGATCAGTCTCGTTTGCAGTCACCGTTCCAGTGCCAC
CCCAGTGTACAGCTCTCCCCGCCATCTTCCGCACCTCCCTCGCCTACTTTCTCCTCTCCGACCTTCTCGACTTCT
TACCCGCAGACGTCTGACTGTCAGTCTTTCGGGGCTCCTTCGATGACCCCAGCGTCTTCATATAACCCGTCATAC
GACATCCAGGGTTCTAATTCACCATCGCACTACCTGTCGCAATATCCTCAGCAATATTATACGCCCATGCTGGTA
CAACAGCCGCTCGCTAGTAACCAGGGTTGGGATAGCAACCTGCAGTTGTTGAGCCCTGCGCGCATCCCATACCCC
GGTGTGCAAAAGCGATCCTCACCCTCGGCATCCTCGCGCTCAGCTCACGCAGGGTTGCCCGCCAACAACTACCAC
CGCCGCTCAAACAGCGCCAACAAGCCGCTACCCACCCCGGTGCAAACCCCTCTCCAGAACTCATTCCTTGCGACT
CCATTCCAAAGTTTCGATCCCTCCTCCCAAGATGGTCACAATGCCGAGGCCGAGTCTGCCATGAGAAAAGCGATC
ATGGACCAACAGAAGCAGTCACCGCAGCAAATGCAGAACGACTACTCCCTGGCTCCATCGGCGTCATCGATGAGC
CATAATTCACCGGTGACTCCGCAGACTACCCTCGATGAACTCGACGATGCATCCAAGTCGATGACCAATGAATAC
AATGCCAATGGTGCCATGTCAATTGGAGTCCCCAAGCTGAACAGAACGATTTCCGATATCTACCAAGACGAATTG
TACAACCCCGCCATCATGGCAGCGCCTCAGATGTCCAAGCCAATGGGACAGAATCACCTCAACCCGCGCAATTTC
ATTGCCGATCGTCTTCAAGCTGCTAACCAAGGACACTTGTCAGCTCGTTCGCAATCGCCTGGCGGCAGACGGGAT
CGCTCACCTTTCCGTACTTCTTCCCCATTCGCCGGTGATATGAGTAACAACGCTCTCCAGCAGCCCCAGATGGCC
ACCAGCGTCCCCATGGGACAGAACGCAATGAATGGGTTGAACGGAATGAACATGGACCAGACCACAACTGGAGAT
ATCAAGACTATGTCCCCCAAGGATGCGGTTTTGGATTTCCAAGACAACGATGATTCCATGCCTCCTCTGTTCCCT
CCGGGTCAGGCTGATTTCAACCTGGGTGATGCGCTTGGCTTGCGCCGCGATACTGGCCCAATGCGACCGATGGAA
GCATTCCCTCAGTATTCGACACCTAGCATGGCCCAGCCACAGTTCGCATTCTCTGAACCTCAGATGCATCGCCCT
CAGAACCTCTTGCCGCAGGGTACCGATTTCCCTTCGCTCCCAGCAGTGGAATCTACCGAGAGCTCGCCTCCAAGT
CAAATGAATATGTCCATTACAGAGAGCATTCCTCGTCCCGACAACACGTCTTCGGATGCGGGCACCTACACTTGC
ACATATCACAACTGCACAGACCGCTTCGACTCTCCCTCTAGACTCCAGCGACATAAGCGCGAGGCGCACCGACAA
ACTACACCGGGCGGCCACCTTGTCAGCCGCGATACCTCGCTCCGCAACTCCCAGGCTGGCCCGCACAAGTGCGAA
CGCATCAACCCGTCTACAGGCAAAGCATGCAATTCTATCTTCTCCCGGCCTTACGATCTTACACGGCACGAGCAT
ACGATTCACACTGCTGGAAAGCAGAAGGTGCGCTGCCACATCTGTAACGAGGACAAGACCTTCAGCCGAAACGAT
GCTTTGACAAGACATATGCGAGTGGTTCATCCCGAGATCGACTGGCCAGGCAAGCAGCGCAGAAGGAGAGACTGA
Gene >Pro_DTO377G3_2|g5979.t1
ATGCTTATGTACCCACGTAAGGGTCTCATCACCGATCCATACAACCCTGAGGGCATCATCATACAAGACGACCAA
TACCCACCGGATTTCTATTCTGAGAACGCCTTGCACTACGATCAGTCTCGTTTGCAGTCACCGTTCCAGTGCCAC
CCCAGTGTACAGCTCTCCCCGCCATCTTCCGCACCTCCCTCGCCTACTTTCTCCTCTCCGACCTTCTCGACTTCT
TACCCGCAGACGTCTGACTGTCAGTCTTTCGGGGCTCCTTCGATGACCCCAGCGTCTTCATATAACCCGTCATAC
GACATCCAGGGTTCTAATTCACCATCGCACTACCTGTCGCAATATCCTCAGCAATATTATACGCCCATGCTGGTA
CAACAGCCGCTCGCTAGTAACCAGGGTTGGGATAGCAACCTGCAGTTGTTGAGCCCTGCGCGCATCCCATACCCC
GGTGTGCAAAAGCGATCCTCACCCTCGGCATCCTCGCGCTCAGCTCACGCAGGGTTGCCCGCCAACAACTACCAC
CGCCGCTCAAACAGCGCCAACAAGCCGCTACCCACCCCGGTGCAAACCCCTCTCCAGAACTCATTCCTTGCGACT
CCATTCCAAAGTTTCGATCCCTCCTCCCAAGATGGTCACAATGCCGAGGCCGAGTCTGCCATGAGAAAAGCGATC
ATGGACCAACAGAAGCAGTCACCGCAGCAAATGCAGAACGACTACTCCCTGGCTCCATCGGCGTCATCGATGAGC
CATAATTCACCGGTGACTCCGCAGACTACCCTCGATGAACTCGACGATGCATCCAAGTCGATGACCAATGGTGAG
AATCGAATTTCTGATATTGATTTATGGATGGACCAGTACTTACATTTCGATCCTCCAGAATACAATGCCAATGGT
GCCATGTCAATTGGAGTCCCCAAGCTGAACAGAACGATTTCCGATATCTACCAAGACGAATTGTACAACCCCGCC
ATCATGGCAGCGCCTCAGATGTCCAAGCCAATGGGACAGAATCACCTCAACCCGCGCAATTTCATTGCCGATCGT
CTTCAAGCTGCTAACCAAGGACACTTGTCAGCTCGTTCGCAATCGCCTGGCGGCAGACGGGATCGCTCACCTTTC
CGTACTTCTTCCCCATTCGCCGGTGATATGAGTAACAACGCTCTCCAGCAGCCCCAGATGGCCACCAGCGTCCCC
ATGGGACAGAACGCAATGAATGGGTTGAACGGAATGAACATGGACCAGACCACAACTGGAGATATCAAGACTATG
TCCCCCAAGGATGCGGTTTTGGATTTCCAAGACAACGATGATTCCATGCCTCCTCTGTTCCCTCCGGGTCAGGCT
GATTTCAACCTGGGTGATGCGCTTGGCTTGCGCCGCGATACTGGCCCAATGCGACCGATGGAAGCATTCCCTCAG
TATTCGACACCTAGCATGGCCCAGCCACAGTTCGCATTCTCTGAACCTCAGATGCATCGCCCTCAGAACCTCTTG
CCGCAGGGTACCGATTTCCCTTCGCTCCCAGCAGTGGAATCTACCGAGAGCTCGCCTCCAAGTCAAATGAATATG
TCCATTACAGAGAGCATTCCTCGTCCCGACAACACGTCTTCGGATGCGGGCACCTACACTTGCACATATCACAAC
TGCACAGACCGCTTCGACTCTCCCTCTAGACTCCAGCGACATAAGCGCGAGGCGCACCGACAAACTACACCGGGC
GGCCACCTTGTCAGCCGCGATACCTCGCTCCGCAACTCCCAGGCTGGCCCGCACAAGTGCGAACGCATCAACCCG
TCTACAGGCAAAGCATGCAATTCTATCTTCTCCCGGCCTTACGATCTTACACGGCACGAGCATACGATTCACACT
GCTGGAAAGCAGAAGGTGCGCTGCCACATCTGTAACGAGGACAAGACCTTCAGCCGAAACGATGCTTTGACAAGA
CGTAAGTTTTCCCCTTTTCGCTTTCACCCCTTAAGTTGGTCATACACTAATTACATTAATTACAGATATGCGAGT
GGTTCATCCCGAGATCGACTGGCCAGGCAAGCAGCGCAGAAGGAGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail