Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5944.t1
Gene name
Locationscaffold_15:207226..212026
Strand-
Gene length (bp)4800
Transcript length (bp)4224
Coding sequence length (bp)4224
Protein length (aa) 1408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 1.0E-83 260 482
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 1.2E-13 620 735
PF01476 LysM LysM domain 1.7E-03 1188 1232

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.03 11.43 26.63
5d_25C Five days - 25 degrees Celsius 18.76 11.33 26.18
7d_25C Seven days - 25 degrees Celsius 21.72 13.22 30.21
10d_25C Ten days - 25 degrees Celsius 28.27 17.18 39.37
7d_15C Seven days - 15 degrees Celsius 7.57 4.01 11.14
7d_30C Seven days - 30 degrees Celsius 22.57 13.73 31.42

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.969854 no
3d_25C 7d_25C 0.638639 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.515316 no
3d_25C 10d_25C 0.072817 no
5d_25C 7d_25C 0.585857 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.462537 no
5d_25C 10d_25C 0.056008 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.908270 no
7d_25C 10d_25C 0.268682 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.363880 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5944.t1
MAGVIFVLRWLLLICQITGIWAIHAHHSHEHLHQHFNRQNVASVSVTVSSSSAAASSSSQFGNSDAATKVSEALR
ALAVVNKLRVDNVKFNRYSMANAKDVTGERINAPPLDYSRGAVTRLSALQNASESELSKEKRQESTNTNDSFAYT
IPKDLADAARALAESVRPTASTGEEEALAAKVHAKYRSKTNDTNRPPQRLQHPNGLFGYVADEQTVLQSSDLQSE
NSTLVKRAASGSDYWLANLQQNAASPFAPSGYKVWRNVKDYGAKGDGVTDDTAAINKAISSGNRCGANCGSSTIF
PAILFFPPGTYLVSSPIIQYYNTQFLGDPTNYPTILAAASFVGLGVITSDVYVGDQEQWYLNTNNFLRNVRNFKM
DITRTDPGAYVCAIHWQVAQGTTLENIEFYMSQATGNTQQGIYMENGSGGFMSNLTFVGGNFGAYLGNQQFTTSQ
LVFVNCKTAVQVHWDWAWTMQDVVIESCGSGIVVTGGAGGLESTGQAVGSYILVDAIIANTPTGIRTSLYADNST
AVLLQNVGFFNVKDAIVADTRTEPLLAGGNEVLVPSWGFGLYHDDTGLHFAQQEQLQVLNRKSILTSDKSYVKGT
ANFFARRRPQYLDLGGGQVFDVKAYGAKGDGVTDDTAALNSVLSAAANMSSIVHFPYGVYVIKDTLHVPLGSRII
GQVWPQIMATGSKFEDAENPHVAVQVGKEGDTGILEIQNMMFTVSGPTAGAVLMEWNVHESTQGSAGLWDCHFRV
GGAIGSKLQSDKCSKKASSLNKDCIAASLLLHVTKSASAYIENLWAWVADHDLDKVTQDQVDIYVARGILVESQG
PTWMYGTASEHSVFYQYQFSGAKNLVMGMIQTESPYFQPTPPMPKPFELGKFPNDPDSNECKTCTSSWAVRMINS
ESIYMLGAGIYSWFNSYSQDCLETNNCQEKAFYVEQSSDIWIVNLVTKAIVQSISPLGETAIFAKDARNGYLSSL
LGWFRKAKDIVGQRKFTGFYFYDKTYQQEFLSQLSPICQTAITRLIDCDDEVYMFQKPRWRQGFDNDTLSDLVCS
SSCGQSIETWFHQVTTNCGSNEETGAPFNMKGGATWAGWNETCAKDATSGKYCGDVINGFNPDLDSMPTAELCSS
CHVGRYRMMQSTPYSAYDINFQSQLKYINSKCNLNIPTDIPDPLQPTIDPYKPADSCVSGIKYTTVAGDTCDSIA
TKYKVSSAALFIGHDNLFECKDIQVGTKLCMPIQCETVYTIKGEDSCTSIEKAQGVGYKDGTTLRKYNPWINYDC
SNLHIVSDVAYGHVICLTPQSGASNATALPYDPTSPGSADGYVIPQIEPPKNSTVAEGTTTRCGKWHVVTNEALQ
ETCTTICIQSKIPWGLFLDVNPSLGPDKCSDQLVAGNAYCVGPTYSWDEFFDDADTD*
Coding >Pro_DTO377G3_2|g5944.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGAC
GACACTGCCGCAATCAATAAAGCTATCTCCAGTGGAAATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTC
CCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCGTCAGCAGTCCGATCATCCAGTATTACAACACGCAATTC
CTGGGAGATCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGGCTTGGGCGTCATTACCTCTGAC
GTTTATGTCGGCGACCAAGAGCAATGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATG
GATATTACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAA
AATATCGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGGCATCTACATGGAAAACGGAAGTGGCGGT
TTCATGAGCAATTTAACCTTCGTGGGTGGAAACTTCGGTGCCTATCTGGGTAACCAACAGTTTACAACCAGTCAA
CTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGCGTGGACAATGCAAGATGTTGTCATA
GAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGTTCA
TACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCAACG
GCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCTCTC
CTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCATTTT
GCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGAACC
GCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCCTAT
GGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATGTCT
TCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATTATC
GGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTGCAA
GTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCTGGT
GCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGATTGTCACTTCCGCGTG
GGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTGTATC
GCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGCGGAC
CATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCAGGGA
CCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAATCTG
GTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACTGGGG
AAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAACTCG
GAATCAATCTATATGCTTGGTGCAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAAC
AACTGCCAAGAAAAGGCTTTCTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATT
GTCCAGTCTATCAGCCCACTCGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTG
CTTGGGTGGTTCCGCAAAGCAAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACA
TATCAGCAAGAGTTTTTGTCACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGAT
GAGGTTTATATGTTCCAAAAGCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGT
TCCAGTTGCGGGCAGTCTATAGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGG
GCTCCCTTCAACATGAAAGGTGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGT
AAATACTGTGGAGACGTAATCAATGGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCA
TGCCATGTCGGCCGTTACCGAATGATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTC
AAATACATCAATTCAAAATGCAACCTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCA
TACAAGCCTGCAGACTCGTGCGTATCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCT
ACCAAGTACAAAGTCTCCTCAGCCGCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTC
GGCACAAAGCTGTGCATGCCAATCCAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATC
GAGAAGGCACAAGGCGTCGGATACAAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGC
TCTAATCTTCATATTGTCAGTGATGTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAAT
GCCACTGCCCTGCCTTATGATCCAACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCT
AAAAACTCAACTGTTGCTGAAGGGACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAA
GAAACCTGCACTACGATATGCATACAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGT
CCGGATAAATGCAGCGACCAGCTGGTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTC
TTTGATGATGCTGATACTGATTGA
Transcript >Pro_DTO377G3_2|g5944.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGAC
GACACTGCCGCAATCAATAAAGCTATCTCCAGTGGAAATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTC
CCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCGTCAGCAGTCCGATCATCCAGTATTACAACACGCAATTC
CTGGGAGATCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGGCTTGGGCGTCATTACCTCTGAC
GTTTATGTCGGCGACCAAGAGCAATGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATG
GATATTACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAA
AATATCGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGGCATCTACATGGAAAACGGAAGTGGCGGT
TTCATGAGCAATTTAACCTTCGTGGGTGGAAACTTCGGTGCCTATCTGGGTAACCAACAGTTTACAACCAGTCAA
CTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGCGTGGACAATGCAAGATGTTGTCATA
GAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGTTCA
TACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCAACG
GCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCTCTC
CTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCATTTT
GCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGAACC
GCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCCTAT
GGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATGTCT
TCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATTATC
GGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTGCAA
GTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCTGGT
GCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGATTGTCACTTCCGCGTG
GGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTGTATC
GCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGCGGAC
CATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCAGGGA
CCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAATCTG
GTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACTGGGG
AAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAACTCG
GAATCAATCTATATGCTTGGTGCAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAAC
AACTGCCAAGAAAAGGCTTTCTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATT
GTCCAGTCTATCAGCCCACTCGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTG
CTTGGGTGGTTCCGCAAAGCAAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACA
TATCAGCAAGAGTTTTTGTCACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGAT
GAGGTTTATATGTTCCAAAAGCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGT
TCCAGTTGCGGGCAGTCTATAGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGG
GCTCCCTTCAACATGAAAGGTGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGT
AAATACTGTGGAGACGTAATCAATGGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCA
TGCCATGTCGGCCGTTACCGAATGATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTC
AAATACATCAATTCAAAATGCAACCTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCA
TACAAGCCTGCAGACTCGTGCGTATCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCT
ACCAAGTACAAAGTCTCCTCAGCCGCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTC
GGCACAAAGCTGTGCATGCCAATCCAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATC
GAGAAGGCACAAGGCGTCGGATACAAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGC
TCTAATCTTCATATTGTCAGTGATGTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAAT
GCCACTGCCCTGCCTTATGATCCAACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCT
AAAAACTCAACTGTTGCTGAAGGGACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAA
GAAACCTGCACTACGATATGCATACAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGT
CCGGATAAATGCAGCGACCAGCTGGTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTC
TTTGATGATGCTGATACTGATTGA
Gene >Pro_DTO377G3_2|g5944.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTAACCCACCTTTATCTGACTTCTACCTGTATCTAGCTAATGTTACTATTA
CCAGGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGACGACACTGGTAAGATAGAAGC
CGTCAATTACTCTCAGCATATAACTAACTGTTCGACTCTCTAAAGCCGCAATCAATAAAGCTATCTCCAGTGGAA
ATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTCCCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCG
TCAGCAGTCCGATCATCCAGTATTACAACACGCAATTCCTGGGAGATGTATGGTAGAACCTTTCGTTCTCTTATT
ATGAGCCATCCACTGATTCCAAACCATTTAGCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGG
CTTGGGCGTCATTACCTCTGACGTTTATGTCGGCGACCAAGAGCAATGGTAAGTACCAAGCCCCAACTGTGCGAA
TTTGTCTAACACCATATCAAGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATGGATAT
TACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAAAATAT
CGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGTATGTAAGCTTCCATAATTCAAGTATTCCATTTA
CTGACTGTCAAGGGCATCTACATGGAAAACGGAAGTGGCGGTTTCATGAGCAATTTAACCTTCGTGGGTGGAAAC
TTCGGGTACGAGTTCACAAATTGCCAATGAGAAAAAGCTGATGTATTTATGCATGGATTATAGTGCCTATCTGGG
TAACCAACAGTTTACAACCAGTCAACTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGC
GTGGACAATGCAAGATGTTGTCATAGAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGTGAGTGTTCCCGT
TCAACAGATCTAAGACGAGTCATTGCTAATCTATATCAGGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGT
TCATACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCA
ACGGCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCT
CTCCTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCAT
TTTGCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGA
ACCGCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCC
TATGGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATG
TCTTCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATT
ATCGGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTG
CAAGTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCT
GGTGCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGGTGAGTCTTTTCCT
TACTGAGAATACCAACTGCGCGGACCATTTATGTTTTTGCATGAGATAACTAACAAAAACAGATTGTCACTTCCG
CGTGGGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTG
TATCGCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGC
GGACCATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCA
GGGACCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAA
TCTGGTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACT
GGGGAAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAA
CTCGGAATCAATCTATATGCTTGGTGCAGGTATGTTTTCTTTTTTTCGGTCTTAACTTAGGCTTTTGCTGACTTT
CCTAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAACAACTGCCAAGAAAAGGCTTT
CTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATTGTCCAGTCTATCAGCCCACT
CGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTGCTTGGGTGGTTCCGCAAAGC
AAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACATATCAGCAAGAGTTTTTGTC
ACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGATGAGGTTTATATGTTCCAAAA
GCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGTTCCAGTTGCGGGCAGTCTAT
AGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGGGCTCCCTTCAACATGAAAGG
TGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGTAAATACTGTGGAGGTAAGCG
TGCATCCCCCGCCCCCGTTTACTTGCGCTTGCACTTGATCGATCCTAACCATGAATACACATAGACGTAATCAAT
GGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCATGCCATGTCGGCCGTTACCGAATG
ATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTCAAATACATCAATTCAAAATGCAAC
CTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCATACAAGCCTGCAGACTCGTGCGTA
TCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCTACCAAGTACAAAGTCTCCTCAGCC
GCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTCGGCACAAAGCTGTGCATGCCAATC
CAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATCGAGAAGGCACAAGGCGTCGGATAC
AAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGCTCTAATCTTCATATTGTCAGTGAT
GTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAATGCCACTGCCCTGCCTTATGATCCA
ACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCTAAAAACTCAACTGTTGCTGAAGGG
ACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAAGAAACCTGCACTACGATATGCATA
CAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGTCCGGATAAATGCAGCGACCAGCTG
GTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTCTTTGATGATGCTGATACTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail