Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5941.t1
Gene name
Locationscaffold_15:199192..201925
Strand+
Gene length (bp)2733
Transcript length (bp)2568
Coding sequence length (bp)2568
Protein length (aa) 856

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00653 BIR Inhibitor of Apoptosis domain 1.9E-23 11 96
PF00653 BIR Inhibitor of Apoptosis domain 1.8E-22 123 195

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.13 10.81 27.46
5d_25C Five days - 25 degrees Celsius 15.10 8.00 22.20
7d_25C Seven days - 25 degrees Celsius 14.96 7.83 22.10
10d_25C Ten days - 25 degrees Celsius 8.18 3.67 12.68
7d_15C Seven days - 15 degrees Celsius 14.61 6.83 22.39
7d_30C Seven days - 30 degrees Celsius 15.34 8.15 22.54

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.404011 no
3d_25C 7d_25C 0.386010 no
3d_25C 7d_15C 0.375658 no
3d_25C 7d_30C 0.453151 no
3d_25C 10d_25C 0.001804 yes
5d_25C 7d_25C 0.983368 no
5d_25C 7d_15C 0.939932 no
5d_25C 7d_30C 0.971143 no
5d_25C 10d_25C 0.027506 yes
7d_25C 7d_15C 0.957768 no
7d_25C 7d_30C 0.952797 no
7d_25C 10d_25C 0.029770 yes
7d_15C 7d_30C 0.910799 no
7d_15C 10d_25C 0.050710 no
7d_30C 10d_25C 0.022435 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5941.t1
MGSEMDTFAARLASFDLVLKPEKRRSSGTKTPKAITWPHQRPSPAELAHAGFYYKPYETNPDNTTCFQCHRALDG
WEEDDNPITEHLKHAPDCGWAIMMDLQQSSSNPASIEDPTGDRITQARLATFGTVWPHDGKKGWVCQSEKMVEGG
WYFCPTDESNDLASCVYCKLSLDGWEPKDDPFDEHYRRSSDCSFFVFAQPPGKKSKSARAKKPRVSKASSRLSTQ
SVGSVASEAPDMEVDDPMGQSIMSQSSTKSKSTKKAPKSKSKGTKTKKEEPAEVESQIDAEIEEVAQTEPVKPKR
AGKGKKRTSEDIKDEPNPVAMEEKEPSQPPAEPPAKRRDTKTRSSSITRSYNYEHSDSAMADARPVDEATSEEET
TRGRKPTRKRASKTRKVSDVPVASKAPSKARAPRDSEIEAEIEAGLEADIPTPAEPEPEIEAEPAEPRASKKTKS
SKKSKAVARIPEATVHNQVEDVSDREDRSDPHVEPVDDEPEAPAPKTKLAKGSKKKGTKKTKTEETIKAQSPEPR
ESLGLRGPDVRDDSERHDSFVSVEIISKEPENAPEPEEPIAKAESKKISKKKDGTSTKEKKSKKSEKKAEQAPVL
QPSVEEHRAEPSVEEQDDEFETTDDLPDQLEIVNPSPPQQISPEPQSHIKTPSLPPKTAKRYSDIPHEEHLAETL
VQSQISPHEVHEPRRNSNRSNRAVSPLPPAHQNTPSPSPQSSDAENRPPSRPSASRAPVQPTPKQPEFRVPLAVS
TPSPSKRNANGGFGPSGHPWTPVDIDEVLFGEASEKENADLSGLFRGAKASLTSPEKKMTVQEWIAWNAKNGEER
LKRECERLVSQFEKEGGRAMRRLEAIECID*
Coding >Pro_DTO377G3_2|g5941.t1
ATGGGCTCTGAAATGGATACCTTTGCGGCCCGCCTAGCCAGCTTCGATTTAGTGCTGAAGCCGGAGAAACGCAGA
TCTTCCGGCACAAAAACACCCAAAGCGATTACATGGCCGCACCAGCGACCTTCACCAGCTGAGTTGGCACACGCT
GGATTCTACTACAAACCATACGAGACAAATCCCGACAACACAACATGTTTCCAGTGCCACCGGGCGCTGGATGGC
TGGGAGGAGGACGACAATCCCATCACAGAGCATCTCAAGCATGCGCCCGACTGCGGATGGGCCATCATGATGGAC
CTCCAACAGAGTAGCTCCAACCCCGCCTCGATTGAAGACCCTACGGGCGACCGAATTACGCAAGCGAGACTGGCA
ACATTTGGTACAGTGTGGCCTCATGACGGGAAAAAGGGCTGGGTATGCCAGTCGGAGAAGATGGTAGAAGGCGGA
TGGTATTTCTGCCCTACAGACGAGAGCAATGACCTGGCCAGTTGTGTCTATTGCAAGTTGTCTTTGGACGGTTGG
GAGCCCAAAGACGACCCATTTGACGAACACTATCGCCGCTCCTCGGATTGTTCATTCTTTGTCTTCGCCCAGCCA
CCAGGAAAGAAGAGCAAATCCGCTCGTGCTAAGAAACCTCGGGTTTCCAAGGCATCCTCCCGGCTCTCAACCCAG
TCCGTTGGTTCAGTTGCATCCGAAGCGCCCGATATGGAAGTAGATGACCCGATGGGCCAAAGCATCATGTCCCAA
TCCAGCACAAAATCCAAATCTACGAAGAAGGCACCGAAGAGCAAATCAAAGGGGACCAAGACTAAGAAGGAAGAA
CCAGCGGAGGTGGAAAGCCAAATTGACGCCGAAATTGAAGAAGTCGCCCAAACAGAGCCTGTCAAACCTAAACGT
GCAGGCAAAGGAAAGAAGAGGACCAGTGAGGATATCAAGGATGAACCAAACCCAGTTGCCATGGAGGAAAAAGAG
CCATCGCAGCCGCCAGCAGAACCTCCAGCGAAGAGACGCGACACAAAAACACGCAGCAGCAGCATTACTCGCAGC
TACAATTATGAACACAGTGACTCTGCAATGGCAGACGCAAGGCCGGTGGATGAAGCTACTTCGGAAGAAGAAACC
ACGAGAGGTCGCAAGCCCACGAGAAAGAGAGCGTCCAAGACCCGCAAGGTCTCCGATGTTCCTGTTGCATCAAAA
GCCCCGTCAAAGGCGCGAGCTCCTCGTGACTCCGAGATCGAAGCGGAAATCGAAGCAGGCCTCGAAGCTGATATC
CCCACACCTGCCGAACCCGAGCCTGAGATCGAGGCTGAGCCAGCAGAGCCACGGGCGTCGAAGAAGACAAAATCG
AGCAAAAAGTCCAAGGCTGTGGCTAGAATTCCCGAAGCGACCGTGCATAATCAAGTAGAAGATGTCAGTGATCGC
GAGGACCGTTCAGATCCCCACGTGGAACCGGTTGATGATGAACCGGAGGCGCCAGCCCCAAAGACCAAGCTGGCA
AAAGGATCTAAGAAGAAGGGGACAAAGAAAACCAAGACCGAGGAGACGATAAAAGCACAGTCGCCAGAGCCTCGA
GAATCCTTAGGGCTCAGGGGTCCCGATGTTCGGGATGATTCCGAGCGTCATGACTCCTTCGTCTCCGTCGAGATT
ATTAGCAAGGAGCCGGAGAATGCACCGGAGCCCGAAGAACCAATCGCCAAGGCTGAATCGAAGAAGATTTCCAAG
AAGAAGGATGGCACATCAACGAAAGAGAAGAAGTCCAAGAAATCCGAGAAAAAGGCGGAGCAAGCTCCTGTTCTT
CAACCCTCAGTCGAAGAACATCGCGCCGAACCGTCAGTCGAGGAACAAGACGATGAATTCGAGACTACAGACGAT
TTGCCTGACCAGCTTGAGATAGTCAACCCTTCCCCTCCACAACAAATATCTCCCGAGCCACAATCTCATATTAAG
ACACCCAGTCTACCGCCAAAGACTGCCAAACGGTATAGCGATATCCCACACGAAGAGCATCTTGCGGAGACCTTA
GTCCAAAGCCAGATCTCCCCTCACGAAGTGCATGAGCCTCGACGGAATTCAAACCGCTCTAACCGGGCCGTTTCA
CCACTTCCTCCAGCCCACCAAAACACTCCCTCGCCGTCACCCCAGTCATCAGATGCAGAAAACCGGCCGCCATCG
CGGCCCTCAGCATCCCGTGCACCAGTCCAACCAACACCCAAGCAACCTGAGTTCCGAGTCCCCCTGGCAGTTAGT
ACCCCATCGCCATCTAAGCGCAACGCCAATGGTGGATTCGGACCTTCTGGCCATCCATGGACACCGGTGGATATT
GATGAAGTGCTGTTTGGAGAGGCTAGCGAGAAGGAAAACGCAGATTTATCCGGACTGTTCAGAGGCGCGAAAGCC
AGCTTGACTAGCCCAGAGAAGAAAATGACAGTCCAAGAATGGATCGCGTGGAACGCAAAGAATGGCGAAGAACGA
CTGAAGCGAGAATGCGAGCGACTTGTCAGCCAATTCGAGAAGGAAGGTGGCCGAGCAATGCGACGGCTCGAAGCT
ATCGAGTGCATCGACTAA
Transcript >Pro_DTO377G3_2|g5941.t1
ATGGGCTCTGAAATGGATACCTTTGCGGCCCGCCTAGCCAGCTTCGATTTAGTGCTGAAGCCGGAGAAACGCAGA
TCTTCCGGCACAAAAACACCCAAAGCGATTACATGGCCGCACCAGCGACCTTCACCAGCTGAGTTGGCACACGCT
GGATTCTACTACAAACCATACGAGACAAATCCCGACAACACAACATGTTTCCAGTGCCACCGGGCGCTGGATGGC
TGGGAGGAGGACGACAATCCCATCACAGAGCATCTCAAGCATGCGCCCGACTGCGGATGGGCCATCATGATGGAC
CTCCAACAGAGTAGCTCCAACCCCGCCTCGATTGAAGACCCTACGGGCGACCGAATTACGCAAGCGAGACTGGCA
ACATTTGGTACAGTGTGGCCTCATGACGGGAAAAAGGGCTGGGTATGCCAGTCGGAGAAGATGGTAGAAGGCGGA
TGGTATTTCTGCCCTACAGACGAGAGCAATGACCTGGCCAGTTGTGTCTATTGCAAGTTGTCTTTGGACGGTTGG
GAGCCCAAAGACGACCCATTTGACGAACACTATCGCCGCTCCTCGGATTGTTCATTCTTTGTCTTCGCCCAGCCA
CCAGGAAAGAAGAGCAAATCCGCTCGTGCTAAGAAACCTCGGGTTTCCAAGGCATCCTCCCGGCTCTCAACCCAG
TCCGTTGGTTCAGTTGCATCCGAAGCGCCCGATATGGAAGTAGATGACCCGATGGGCCAAAGCATCATGTCCCAA
TCCAGCACAAAATCCAAATCTACGAAGAAGGCACCGAAGAGCAAATCAAAGGGGACCAAGACTAAGAAGGAAGAA
CCAGCGGAGGTGGAAAGCCAAATTGACGCCGAAATTGAAGAAGTCGCCCAAACAGAGCCTGTCAAACCTAAACGT
GCAGGCAAAGGAAAGAAGAGGACCAGTGAGGATATCAAGGATGAACCAAACCCAGTTGCCATGGAGGAAAAAGAG
CCATCGCAGCCGCCAGCAGAACCTCCAGCGAAGAGACGCGACACAAAAACACGCAGCAGCAGCATTACTCGCAGC
TACAATTATGAACACAGTGACTCTGCAATGGCAGACGCAAGGCCGGTGGATGAAGCTACTTCGGAAGAAGAAACC
ACGAGAGGTCGCAAGCCCACGAGAAAGAGAGCGTCCAAGACCCGCAAGGTCTCCGATGTTCCTGTTGCATCAAAA
GCCCCGTCAAAGGCGCGAGCTCCTCGTGACTCCGAGATCGAAGCGGAAATCGAAGCAGGCCTCGAAGCTGATATC
CCCACACCTGCCGAACCCGAGCCTGAGATCGAGGCTGAGCCAGCAGAGCCACGGGCGTCGAAGAAGACAAAATCG
AGCAAAAAGTCCAAGGCTGTGGCTAGAATTCCCGAAGCGACCGTGCATAATCAAGTAGAAGATGTCAGTGATCGC
GAGGACCGTTCAGATCCCCACGTGGAACCGGTTGATGATGAACCGGAGGCGCCAGCCCCAAAGACCAAGCTGGCA
AAAGGATCTAAGAAGAAGGGGACAAAGAAAACCAAGACCGAGGAGACGATAAAAGCACAGTCGCCAGAGCCTCGA
GAATCCTTAGGGCTCAGGGGTCCCGATGTTCGGGATGATTCCGAGCGTCATGACTCCTTCGTCTCCGTCGAGATT
ATTAGCAAGGAGCCGGAGAATGCACCGGAGCCCGAAGAACCAATCGCCAAGGCTGAATCGAAGAAGATTTCCAAG
AAGAAGGATGGCACATCAACGAAAGAGAAGAAGTCCAAGAAATCCGAGAAAAAGGCGGAGCAAGCTCCTGTTCTT
CAACCCTCAGTCGAAGAACATCGCGCCGAACCGTCAGTCGAGGAACAAGACGATGAATTCGAGACTACAGACGAT
TTGCCTGACCAGCTTGAGATAGTCAACCCTTCCCCTCCACAACAAATATCTCCCGAGCCACAATCTCATATTAAG
ACACCCAGTCTACCGCCAAAGACTGCCAAACGGTATAGCGATATCCCACACGAAGAGCATCTTGCGGAGACCTTA
GTCCAAAGCCAGATCTCCCCTCACGAAGTGCATGAGCCTCGACGGAATTCAAACCGCTCTAACCGGGCCGTTTCA
CCACTTCCTCCAGCCCACCAAAACACTCCCTCGCCGTCACCCCAGTCATCAGATGCAGAAAACCGGCCGCCATCG
CGGCCCTCAGCATCCCGTGCACCAGTCCAACCAACACCCAAGCAACCTGAGTTCCGAGTCCCCCTGGCAGTTAGT
ACCCCATCGCCATCTAAGCGCAACGCCAATGGTGGATTCGGACCTTCTGGCCATCCATGGACACCGGTGGATATT
GATGAAGTGCTGTTTGGAGAGGCTAGCGAGAAGGAAAACGCAGATTTATCCGGACTGTTCAGAGGCGCGAAAGCC
AGCTTGACTAGCCCAGAGAAGAAAATGACAGTCCAAGAATGGATCGCGTGGAACGCAAAGAATGGCGAAGAACGA
CTGAAGCGAGAATGCGAGCGACTTGTCAGCCAATTCGAGAAGGAAGGTGGCCGAGCAATGCGACGGCTCGAAGCT
ATCGAGTGCATCGACTAA
Gene >Pro_DTO377G3_2|g5941.t1
ATGGGCTCTGAAATGGATACCTTTGCGGCCCGCCTAGCCAGCTTCGATTTAGTGCTGAAGCCGGAGAAACGCAGA
TCTTCCGGCACAAAAACACCCAAAGCGATTACATGGCCGCACCAGCGACCTTCACCAGCTGAGGTATGTCATTCT
TCGAAGAGATTACACGCGCCGTTTAAGATGATTGACTTGGCGGGATTATAGTTGGCACACGCTGGATTCTACTAC
AAACCATACGAGACAAATCCCGACAACACAACATGTTTCCAGTGCCACCGGGCGCTGGATGGCTGGGAGGAGGAC
GACAATCCCATCACAGAGCATCTCAAGCATGCGCCCGACTGCGGATGGGCCATCATGATGGACCTCCAACAGAGT
AGCTCCAACCCCGCCTCGATTGAAGACCCTACGGGCGACCGAATTACGCAAGCGAGACTGGCAACATTTGGTACA
GTGTGGCCTCATGACGGGAAAAAGGGCTGGGTATGCCAGTCGGAGAAGGTAAATCGTGACTTCACCGTATTCATA
TTATTTTGGCTCACAACAATGACAGATGGTAGAAGGCGGATGGTATTTCTGCCCTACAGACGAGAGCAATGACCT
GGCCAGTTGTGTCTATTGCAAGTTGTCTTTGGACGGTTGGGAGCCCAAAGACGACCCATTGTGAGTATCCATCGC
TCTTTCTTAGTTGGACGATTGCTGACTTACCCCAGTGACGAACACTATCGCCGCTCCTCGGATTGTTCATTCTTT
GTCTTCGCCCAGCCACCAGGAAAGAAGAGCAAATCCGCTCGTGCTAAGAAACCTCGGGTTTCCAAGGCATCCTCC
CGGCTCTCAACCCAGTCCGTTGGTTCAGTTGCATCCGAAGCGCCCGATATGGAAGTAGATGACCCGATGGGCCAA
AGCATCATGTCCCAATCCAGCACAAAATCCAAATCTACGAAGAAGGCACCGAAGAGCAAATCAAAGGGGACCAAG
ACTAAGAAGGAAGAACCAGCGGAGGTGGAAAGCCAAATTGACGCCGAAATTGAAGAAGTCGCCCAAACAGAGCCT
GTCAAACCTAAACGTGCAGGCAAAGGAAAGAAGAGGACCAGTGAGGATATCAAGGATGAACCAAACCCAGTTGCC
ATGGAGGAAAAAGAGCCATCGCAGCCGCCAGCAGAACCTCCAGCGAAGAGACGCGACACAAAAACACGCAGCAGC
AGCATTACTCGCAGCTACAATTATGAACACAGTGACTCTGCAATGGCAGACGCAAGGCCGGTGGATGAAGCTACT
TCGGAAGAAGAAACCACGAGAGGTCGCAAGCCCACGAGAAAGAGAGCGTCCAAGACCCGCAAGGTCTCCGATGTT
CCTGTTGCATCAAAAGCCCCGTCAAAGGCGCGAGCTCCTCGTGACTCCGAGATCGAAGCGGAAATCGAAGCAGGC
CTCGAAGCTGATATCCCCACACCTGCCGAACCCGAGCCTGAGATCGAGGCTGAGCCAGCAGAGCCACGGGCGTCG
AAGAAGACAAAATCGAGCAAAAAGTCCAAGGCTGTGGCTAGAATTCCCGAAGCGACCGTGCATAATCAAGTAGAA
GATGTCAGTGATCGCGAGGACCGTTCAGATCCCCACGTGGAACCGGTTGATGATGAACCGGAGGCGCCAGCCCCA
AAGACCAAGCTGGCAAAAGGATCTAAGAAGAAGGGGACAAAGAAAACCAAGACCGAGGAGACGATAAAAGCACAG
TCGCCAGAGCCTCGAGAATCCTTAGGGCTCAGGGGTCCCGATGTTCGGGATGATTCCGAGCGTCATGACTCCTTC
GTCTCCGTCGAGATTATTAGCAAGGAGCCGGAGAATGCACCGGAGCCCGAAGAACCAATCGCCAAGGCTGAATCG
AAGAAGATTTCCAAGAAGAAGGATGGCACATCAACGAAAGAGAAGAAGTCCAAGAAATCCGAGAAAAAGGCGGAG
CAAGCTCCTGTTCTTCAACCCTCAGTCGAAGAACATCGCGCCGAACCGTCAGTCGAGGAACAAGACGATGAATTC
GAGACTACAGACGATTTGCCTGACCAGCTTGAGATAGTCAACCCTTCCCCTCCACAACAAATATCTCCCGAGCCA
CAATCTCATATTAAGACACCCAGTCTACCGCCAAAGACTGCCAAACGGTATAGCGATATCCCACACGAAGAGCAT
CTTGCGGAGACCTTAGTCCAAAGCCAGATCTCCCCTCACGAAGTGCATGAGCCTCGACGGAATTCAAACCGCTCT
AACCGGGCCGTTTCACCACTTCCTCCAGCCCACCAAAACACTCCCTCGCCGTCACCCCAGTCATCAGATGCAGAA
AACCGGCCGCCATCGCGGCCCTCAGCATCCCGTGCACCAGTCCAACCAACACCCAAGCAACCTGAGTTCCGAGTC
CCCCTGGCAGTTAGTACCCCATCGCCATCTAAGCGCAACGCCAATGGTGGATTCGGACCTTCTGGCCATCCATGG
ACACCGGTGGATATTGATGAAGTGCTGTTTGGAGAGGCTAGCGAGAAGGAAAACGCAGATTTATCCGGACTGTTC
AGAGGCGCGAAAGCCAGCTTGACTAGCCCAGAGAAGAAAATGACAGTCCAAGAATGGATCGCGTGGAACGCAAAG
AATGGCGAAGAACGACTGAAGCGAGAATGCGAGCGACTTGTCAGCCAATTCGAGAAGGAAGGTGGCCGAGCAATG
CGACGGCTCGAAGCTATCGAGTGCATCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail