Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g594.t1
Gene name
Locationscaffold_01:1528282..1529841
Strand-
Gene length (bp)1559
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 2.1E-53 25 295

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 46.12 27.21 65.03
5d_25C Five days - 25 degrees Celsius 41.90 24.45 59.35
7d_25C Seven days - 25 degrees Celsius 38.40 22.01 54.79
10d_25C Ten days - 25 degrees Celsius 39.48 22.77 56.19
7d_15C Seven days - 15 degrees Celsius 47.47 28.08 66.86
7d_30C Seven days - 30 degrees Celsius 34.24 19.22 49.26

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.758605 no
3d_25C 7d_25C 0.502822 no
3d_25C 7d_15C 0.937419 no
3d_25C 7d_30C 0.235533 no
3d_25C 10d_25C 0.579453 no
5d_25C 7d_25C 0.787466 no
5d_25C 7d_15C 0.670705 no
5d_25C 7d_30C 0.472746 no
5d_25C 10d_25C 0.862263 no
7d_25C 7d_15C 0.427762 no
7d_25C 7d_30C 0.723180 no
7d_25C 10d_25C 0.938154 no
7d_15C 7d_30C 0.183361 no
7d_15C 10d_25C 0.497548 no
7d_30C 10d_25C 0.641176 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g594.t1
MEYLPSLQQEFDEHKPSLFELLAEQQLSDLLPPSLRYLLAVATHRHPRYLLRILNSYDEIYALLSLIVERYYLRT
FGGSFTENFYSLKRERVLRTKNGEIPRAQVGAAGPVREALKLHSTDIWKNLFVMVGIPYLKRKLDEGYDIHAAPH
ASLVTSSGPRYNPSDDLPVNPSLRQRIFFYYKWFLRNVYPSVNAAYYFSVLEFNLAYLFDNTKYSSPFLWLIGTR
IRRLGIADHRAIAAVLDPKPGPSTGRSQRPGGGLLGLLSPQNLHTQLLTSLRYFLPASIFALKFLEWWHASDFSR
QLARKATEVLDLPAPIVAGLTSPAERRKSSIQDEKEKAKKQAEQEKKSAAGDLKPALKPPRRHQPPISATSYLPI
YTVSLPPADPSSANTCPVCMGPLVNPTACQTGYVFCYVCIFHWLNGEHQRQLDFMTGEGAGAPWEEEITGDDEET
KKSPSGDDSEEGPRKRSGKWESGKGRCPVTGRRVLGGTDGLRRVLV*
Coding >Pro_DTO377G3_2|g594.t1
ATGGAGTACCTTCCTAGTCTTCAACAGGAGTTCGACGAGCACAAGCCGTCGCTCTTCGAACTCCTCGCTGAGCAA
CAGCTCTCGGATCTTCTTCCCCCGTCTTTGCGTTATCTTCTCGCAGTCGCAACACACCGCCACCCGCGCTATCTC
CTCCGGATCCTCAACTCATATGACGAAATCTATGCCCTCCTTTCATTAATAGTCGAACGTTACTACCTGCGAACA
TTCGGCGGCTCCTTCACAGAAAACTTCTATTCCTTGAAACGTGAGCGCGTTCTCCGAACCAAGAATGGCGAGATC
CCGCGCGCCCAGGTTGGCGCCGCAGGCCCCGTGCGCGAGGCCCTGAAGCTACACTCGACGGACATCTGGAAGAAC
TTGTTCGTCATGGTTGGAATACCTTACCTAAAGCGCAAGTTAGACGAAGGATACGACATTCATGCCGCGCCACAT
GCATCCCTGGTCACCAGCAGCGGCCCACGATATAATCCCAGCGACGATCTGCCGGTCAACCCGTCGCTACGCCAA
CGCATCTTCTTCTACTACAAGTGGTTCCTGCGCAATGTCTACCCATCCGTGAATGCGGCGTACTATTTCTCTGTT
CTGGAGTTCAACCTAGCCTACCTTTTCGACAACACAAAATACTCCTCCCCATTCCTATGGCTTATCGGCACGCGT
ATCCGCCGCCTCGGCATCGCAGACCACCGCGCTATCGCCGCAGTGCTAGATCCCAAGCCTGGCCCCAGCACCGGG
CGATCTCAGCGACCCGGCGGAGGTCTGCTTGGTCTACTTAGTCCCCAGAACCTCCATACTCAGCTCTTGACCTCG
CTGCGCTACTTCCTTCCTGCGTCGATCTTCGCCCTCAAGTTCCTAGAATGGTGGCATGCAAGCGACTTCTCTCGC
CAGCTAGCCCGCAAGGCAACTGAGGTCCTGGATCTGCCTGCCCCCATTGTGGCAGGTTTGACTTCTCCTGCGGAA
CGACGGAAATCGTCAATCCAAGATGAGAAAGAGAAGGCGAAGAAGCAGGCCGAGCAGGAGAAGAAGAGCGCTGCC
GGCGATCTTAAACCAGCACTCAAGCCTCCTCGTCGCCACCAACCGCCTATTTCAGCGACCTCTTATCTTCCCATC
TACACTGTGTCTTTGCCTCCGGCTGATCCTTCCAGCGCAAATACTTGCCCTGTCTGCATGGGTCCGCTCGTCAAC
CCGACTGCTTGCCAGACGGGGTACGTGTTCTGTTATGTGTGCATCTTCCACTGGCTGAACGGTGAGCATCAGCGC
CAACTGGATTTCATGACCGGCGAGGGCGCTGGCGCACCGTGGGAAGAGGAGATCACAGGTGACGATGAAGAGACA
AAGAAGAGCCCTAGTGGAGATGACTCTGAAGAAGGCCCCCGAAAACGATCTGGTAAATGGGAGAGTGGCAAGGGG
AGGTGTCCTGTAACAGGGAGGAGAGTGCTTGGAGGTACTGATGGATTGAGGAGAGTGTTGGTTTGA
Transcript >Pro_DTO377G3_2|g594.t1
ATGGAGTACCTTCCTAGTCTTCAACAGGAGTTCGACGAGCACAAGCCGTCGCTCTTCGAACTCCTCGCTGAGCAA
CAGCTCTCGGATCTTCTTCCCCCGTCTTTGCGTTATCTTCTCGCAGTCGCAACACACCGCCACCCGCGCTATCTC
CTCCGGATCCTCAACTCATATGACGAAATCTATGCCCTCCTTTCATTAATAGTCGAACGTTACTACCTGCGAACA
TTCGGCGGCTCCTTCACAGAAAACTTCTATTCCTTGAAACGTGAGCGCGTTCTCCGAACCAAGAATGGCGAGATC
CCGCGCGCCCAGGTTGGCGCCGCAGGCCCCGTGCGCGAGGCCCTGAAGCTACACTCGACGGACATCTGGAAGAAC
TTGTTCGTCATGGTTGGAATACCTTACCTAAAGCGCAAGTTAGACGAAGGATACGACATTCATGCCGCGCCACAT
GCATCCCTGGTCACCAGCAGCGGCCCACGATATAATCCCAGCGACGATCTGCCGGTCAACCCGTCGCTACGCCAA
CGCATCTTCTTCTACTACAAGTGGTTCCTGCGCAATGTCTACCCATCCGTGAATGCGGCGTACTATTTCTCTGTT
CTGGAGTTCAACCTAGCCTACCTTTTCGACAACACAAAATACTCCTCCCCATTCCTATGGCTTATCGGCACGCGT
ATCCGCCGCCTCGGCATCGCAGACCACCGCGCTATCGCCGCAGTGCTAGATCCCAAGCCTGGCCCCAGCACCGGG
CGATCTCAGCGACCCGGCGGAGGTCTGCTTGGTCTACTTAGTCCCCAGAACCTCCATACTCAGCTCTTGACCTCG
CTGCGCTACTTCCTTCCTGCGTCGATCTTCGCCCTCAAGTTCCTAGAATGGTGGCATGCAAGCGACTTCTCTCGC
CAGCTAGCCCGCAAGGCAACTGAGGTCCTGGATCTGCCTGCCCCCATTGTGGCAGGTTTGACTTCTCCTGCGGAA
CGACGGAAATCGTCAATCCAAGATGAGAAAGAGAAGGCGAAGAAGCAGGCCGAGCAGGAGAAGAAGAGCGCTGCC
GGCGATCTTAAACCAGCACTCAAGCCTCCTCGTCGCCACCAACCGCCTATTTCAGCGACCTCTTATCTTCCCATC
TACACTGTGTCTTTGCCTCCGGCTGATCCTTCCAGCGCAAATACTTGCCCTGTCTGCATGGGTCCGCTCGTCAAC
CCGACTGCTTGCCAGACGGGGTACGTGTTCTGTTATGTGTGCATCTTCCACTGGCTGAACGGTGAGCATCAGCGC
CAACTGGATTTCATGACCGGCGAGGGCGCTGGCGCACCGTGGGAAGAGGAGATCACAGGTGACGATGAAGAGACA
AAGAAGAGCCCTAGTGGAGATGACTCTGAAGAAGGCCCCCGAAAACGATCTGGTAAATGGGAGAGTGGCAAGGGG
AGGTGTCCTGTAACAGGGAGGAGAGTGCTTGGAGGTACTGATGGATTGAGGAGAGTGTTGGTTTGA
Gene >Pro_DTO377G3_2|g594.t1
ATGGAGTACCTTCCTAGTCTTCAACAGGAGTTCGACGAGCACAAGCCGTCGCTCTTCGGTAAGTCGATTGATGCT
TCCCCGCGTAGTGATTAGAAGCGCTAACGCTAGGTTCGTGCTTGACAACAGAACTCCTCGCTGAGCAACAGCTCT
CGGATCTTCTTCCCCCGTCTTTGCGTTATCTTCTCGCAGTCGCAACACACCGCCACCCGCGCTATCTCCTCCGGA
TCCTCAACTCATATGACGAAATCTATGCCCTCCTTTCATTAATAGTCGAACGTTACTACCTGCGAACATTCGGCG
GCTCCTTCACAGAAAACTTCTATTCCTTGAAACGTGAGCGCGTTCTCCGAACCAAGAATGGCGAGATCCCGCGCG
CCCAGGTTGGCGCCGCAGGCCCCGTGCGCGAGGCCCTGAAGCTACACTCGACGGACATCTGGAAGAACTTGTTCG
TCATGGTTGGAATACCTTACCTAAAGCGCAAGTTAGACGAAGGATACGACATTCATGCCGCGCCACATGCATCCC
TGGTCACCAGCAGCGGCCCACGATATAATCCCAGCGACGATCTGCCGGTCAACCCGTCGCTACGCCAACGCATCT
TCTTCTACTACAAGTGGTTCCTGCGCAATGTCTACCCATCCGTGAATGCGGCGTACTATTTCTCTGTTCTGGAGT
TCAACCTAGCCTACCTTTTCGACAACACAAAATACTCCTCCCCATTCCTATGGCTTATCGGCACGCGTATCCGCC
GCCTCGGCATCGCAGACCACCGCGCTATCGCCGCAGTGCTAGATCCCAAGCCTGGCCCCAGCACCGGGCGATCTC
AGCGACCCGGCGGAGGTCTGCTTGGTCTACTTAGTCCCCAGAACCTCCATACTCAGCTCTTGACCTCGCTGCGCT
ACTTCCTTCCTGCGTCGATCTTCGCCCTCAAGTTCCTAGAATGGTGGCATGCAAGCGACTTCTCTCGCCAGCTAG
CCCGCAAGGCAACTGAGGTCCTGGATCTGCCTGCCCCCATTGTGGCAGGTTTGACTTCTCCTGCGGAACGACGGA
AATCGTCAATCCAAGATGAGAAAGAGAAGGCGAAGAAGCAGGCCGAGCAGGAGAAGAAGAGCGCTGCCGGCGATC
TTAAACCAGCACTCAAGCCTCCTCGTCGCCACCAACCGCCTATTTCAGCGACCTCTTATCTTCCCATCTACACTG
TGTCTTTGCCTCCGGCTGATCCTTCCAGCGCAAATACTTGCCCTGTCTGCATGGGTCCGCTCGTCAACCCGACTG
CTTGCCAGACGGGGTACGTGTTCTGTTATGTGTGCATCTTCCACTGGCTGAACGGTGAGCATCAGCGCCAACTGG
ATTTCATGACCGGCGAGGGCGCTGGCGCACCGTGGGAAGAGGAGATCACAGGTGACGATGAAGAGACAAAGAAGA
GCCCTAGTGGAGATGACTCTGAAGAAGGCCCCCGAAAACGATCTGGTAAATGGGAGAGTGGCAAGGGGAGGTGTC
CTGTAACAGGGAGGAGAGTGCTTGGAGGTACTGATGGATTGAGGAGAGTGTTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail