Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5922.t1
Gene name
Locationscaffold_15:157327..158664
Strand+
Gene length (bp)1337
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01269 Fibrillarin Fibrillarin 1.5E-104 93 326
PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit 1.0E-05 168 284

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0030488 tRNA methylation Yes
GO:0008168 methyltransferase activity Yes
GO:0016429 tRNA (adenine-N1-)-methyltransferase activity Yes
GO:0003723 RNA binding Yes
GO:0031515 tRNA (m1A) methyltransferase complex Yes
GO:0043414 macromolecule methylation No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:1990234 transferase complex No
GO:0016426 tRNA (adenine) methyltransferase activity No
GO:0003824 catalytic activity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0034470 ncRNA processing No
GO:0008033 tRNA processing No
GO:0044444 cytoplasmic part No
GO:0016740 transferase activity No
GO:0006399 tRNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008175 tRNA methyltransferase activity No
GO:0009451 RNA modification No
GO:1901363 heterocyclic compound binding No
GO:0006400 tRNA modification No
GO:0090304 nucleic acid metabolic process No
GO:0034708 methyltransferase complex No
GO:0046483 heterocycle metabolic process No
GO:0044464 cell part No
GO:0043527 tRNA methyltransferase complex No
GO:0006807 nitrogen compound metabolic process No
GO:0008173 RNA methyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:1902494 catalytic complex No
GO:0005488 binding No
GO:0016072 rRNA metabolic process No
GO:0044424 intracellular part No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0003676 nucleic acid binding No
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0001510 RNA methylation No
GO:0032259 methylation No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006396 RNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5922.t1
MSSFAPRGRGGFGGDRGGGRGGRGGFGDRGGRGGGRGGFGDRGGRGGGRGGFGDRGGRGGGRGAPRGGRGAPRGG
RGAPRGGGGARGGAKVVIEPHRHAGIFVARGGKEDMLVTKNLTPGTAVYGEKRISVEGPATEDGTVTKNEYRVWN
PFRSKLAAGVLGGLDDIYMKPGSKVLYIGAASGTSVSHVADIVGPTGNVYAVEFSHRSGRDLIGMATHRTNVIPI
VEDARHPLRYRMLVPMVDVIFADVAQPDQARIVGLNAHMFLKDGGGVIVSVKANCIDSTAKPEVVFAKEVQKMRE
EKIKPKEQLTLEPFERDHCIVAGIYKRTA*
Coding >Pro_DTO377G3_2|g5922.t1
ATGTCTTCTTTCGCTCCTCGTGGACGTGGTGGATTTGGTGGTGATCGCGGCGGTGGCCGTGGTGGTCGAGGTGGC
TTCGGCGACCGTGGTGGCCGTGGAGGTGGCCGTGGTGGCTTCGGTGATCGTGGCGGCCGTGGAGGTGGCCGTGGT
GGATTCGGTGACCGTGGCGGCCGTGGAGGTGGTCGCGGTGCCCCTCGTGGTGGCCGTGGTGCTCCTCGTGGTGGC
CGTGGTGCTCCCCGCGGTGGTGGTGGTGCTCGTGGTGGTGCCAAGGTTGTCATTGAGCCTCACCGTCACGCCGGT
ATCTTCGTCGCTCGCGGTGGTAAGGAAGACATGCTTGTGACGAAAAACCTTACGCCTGGAACTGCTGTCTACGGC
GAGAAGCGCATTTCCGTCGAGGGCCCCGCAACTGAGGATGGTACTGTCACTAAGAACGAGTACCGTGTCTGGAAC
CCCTTCCGTTCTAAGTTGGCTGCTGGTGTGTTGGGTGGTCTTGATGATATCTACATGAAGCCCGGCTCCAAGGTT
CTTTACATCGGTGCTGCCTCCGGTACCTCCGTTTCTCACGTCGCTGATATTGTCGGCCCCACTGGTAACGTCTAC
GCCGTCGAGTTCTCCCACCGCTCTGGCCGTGATCTGATCGGCATGGCCACTCACCGTACCAACGTCATCCCCATT
GTTGAGGATGCCCGTCACCCTCTCCGTTACCGTATGCTCGTCCCCATGGTCGATGTCATCTTTGCCGATGTTGCC
CAGCCCGATCAGGCCCGTATTGTCGGATTGAACGCCCACATGTTCCTCAAGGATGGAGGTGGTGTCATTGTCTCC
GTCAAGGCCAACTGTATTGACAGCACAGCCAAGCCCGAGGTTGTGTTCGCTAAGGAGGTCCAGAAGATGCGCGAG
GAGAAGATTAAGCCCAAGGAGCAGCTGACCCTCGAGCCTTTCGAGCGTGACCACTGTATCGTCGCTGGTATCTAC
AAGCGTACCGCATAA
Transcript >Pro_DTO377G3_2|g5922.t1
ATGTCTTCTTTCGCTCCTCGTGGACGTGGTGGATTTGGTGGTGATCGCGGCGGTGGCCGTGGTGGTCGAGGTGGC
TTCGGCGACCGTGGTGGCCGTGGAGGTGGCCGTGGTGGCTTCGGTGATCGTGGCGGCCGTGGAGGTGGCCGTGGT
GGATTCGGTGACCGTGGCGGCCGTGGAGGTGGTCGCGGTGCCCCTCGTGGTGGCCGTGGTGCTCCTCGTGGTGGC
CGTGGTGCTCCCCGCGGTGGTGGTGGTGCTCGTGGTGGTGCCAAGGTTGTCATTGAGCCTCACCGTCACGCCGGT
ATCTTCGTCGCTCGCGGTGGTAAGGAAGACATGCTTGTGACGAAAAACCTTACGCCTGGAACTGCTGTCTACGGC
GAGAAGCGCATTTCCGTCGAGGGCCCCGCAACTGAGGATGGTACTGTCACTAAGAACGAGTACCGTGTCTGGAAC
CCCTTCCGTTCTAAGTTGGCTGCTGGTGTGTTGGGTGGTCTTGATGATATCTACATGAAGCCCGGCTCCAAGGTT
CTTTACATCGGTGCTGCCTCCGGTACCTCCGTTTCTCACGTCGCTGATATTGTCGGCCCCACTGGTAACGTCTAC
GCCGTCGAGTTCTCCCACCGCTCTGGCCGTGATCTGATCGGCATGGCCACTCACCGTACCAACGTCATCCCCATT
GTTGAGGATGCCCGTCACCCTCTCCGTTACCGTATGCTCGTCCCCATGGTCGATGTCATCTTTGCCGATGTTGCC
CAGCCCGATCAGGCCCGTATTGTCGGATTGAACGCCCACATGTTCCTCAAGGATGGAGGTGGTGTCATTGTCTCC
GTCAAGGCCAACTGTATTGACAGCACAGCCAAGCCCGAGGTTGTGTTCGCTAAGGAGGTCCAGAAGATGCGCGAG
GAGAAGATTAAGCCCAAGGAGCAGCTGACCCTCGAGCCTTTCGAGCGTGACCACTGTATCGTCGCTGGTATCTAC
AAGCGTACCGCATAA
Gene >Pro_DTO377G3_2|g5922.t1
ATGTCTTCTTTCGCTCCTCGTGGACGTGGTGGATTTGGTGGTGATCGCGGCGGTGGCCGTGGTGGTCGAGGTTTG
TTCAGTCCGATCCATTTGAGCAGCAAGCATTCAGGTCCAAAATCTCGCTGGTGATTCTACCGCACCGATGGCCAT
GGTCCTGTTTCTTGTTGCGATACTATAGTTCACATTGCTGACTTGTTGAAGGTGGCTTCGGCGACCGTGGTGGCC
GTGGAGGTGGCCGTGGTGGCTTCGGTGATCGTGGCGGCCGTGGAGGTGGCCGTGGTGGATTCGGTGACCGTGGCG
GCCGTGGAGGTGGTCGCGGTGCCCCTCGTGGTGGCCGTGGTGCTCCTCGTGGTGGCCGTGGTGCTCCCCGCGGTG
GTGGTGGTGCTCGTGGTGGTGCCAAGGTTGTCATTGTAAGTGTTGGAAATTCTCATGGACATGGGTATCAGTCAC
TAACGTAATCTTTTCTCTTGCGAATAGGAGCCTCACCGTCACGCCGGTATCTTCGTCGCTCGCGGTGGTAAGGAA
GACATGCTTGTGACGAAAAACCTTACGCCTGGAACTGCTGTCTACGGCGAGAAGCGCATTTCCGTCGAGGGCCCC
GCAACTGAGGATGGTACTGTCACTAAGAACGAGTACCGTGTCTGGAACCCCTTCCGTTCTAAGGTAAATACTCCT
CCTTATCCTGGGCTAAAGATGCATGGTATCCTTGGCGATTTCATCGAATTTTTCTCGGAATTCTTCAATATCGCC
CCGATAGCCATGGCTGCCTTATTGTTTAGTCCTTCTTTTCTAACGTCTTCTCCCTTTTCTAGTTGGCTGCTGGTG
TGTTGGGTGGTCTTGATGATATCTACATGAAGCCCGGCTCCAAGGTTCTTTACATCGGTGCTGCCTCCGGTACCT
CCGTTTCTCACGTCGCTGATATTGTCGGCCCCACTGGTAACGTCTACGCCGTCGAGTTCTCCCACCGCTCTGGCC
GTGATCTGATCGGCATGGCCACTCACCGTACCAACGTCATCCCCATTGTTGAGGATGCCCGTCACCCTCTCCGTT
ACCGTATGCTCGTCCCCATGGTCGATGTCATCTTTGCCGATGTTGCCCAGCCCGATCAGGCCCGTATTGTCGGAT
TGAACGCCCACATGTTCCTCAAGGATGGAGGTGGTGTCATTGTCTCCGTCAAGGCCAACTGTATTGACAGCACAG
CCAAGCCCGAGGTTGTGTTCGCTAAGGAGGTCCAGAAGATGCGCGAGGAGAAGATTAAGCCCAAGGAGCAGCTGA
CCCTCGAGCCTTTCGAGCGTGACCACTGTATCGTCGCTGGTATCTACAAGCGTACCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail