Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5914.t1
Gene name
Locationscaffold_15:136505..139207
Strand+
Gene length (bp)2702
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18101 Pan3_PK Pan3 Pseudokinase domain 3.5E-62 504 641

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 75.38 46.30 104.47
5d_25C Five days - 25 degrees Celsius 91.84 55.90 127.78
7d_25C Seven days - 25 degrees Celsius 108.34 65.99 150.69
10d_25C Ten days - 25 degrees Celsius 134.62 81.28 187.96
7d_15C Seven days - 15 degrees Celsius 116.33 70.31 162.35
7d_30C Seven days - 30 degrees Celsius 90.59 55.56 125.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.414943 no
3d_25C 7d_25C 0.080312 no
3d_25C 7d_15C 0.034575 yes
3d_25C 7d_30C 0.446715 no
3d_25C 10d_25C 0.003625 yes
5d_25C 7d_25C 0.521299 no
5d_25C 7d_15C 0.323054 no
5d_25C 7d_30C 0.968348 no
5d_25C 10d_25C 0.075931 no
7d_25C 7d_15C 0.819274 no
7d_25C 7d_30C 0.472554 no
7d_25C 10d_25C 0.372883 no
7d_15C 7d_30C 0.282276 no
7d_15C 10d_25C 0.594534 no
7d_30C 10d_25C 0.061637 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5914.t1
MASAGKPPLEDARRTTGSPKMKSRENAKDTLCRNVTIYGRCRYEDKGCAFNHDPSKLNANQSDSKKRFNVDSPSF
TPSLLSGNGVSAPKKSTAISPKAASAAPFQPRTTSSRSNTSTPTTRSEAVQDWAVADVQEFIPQGFEHVTPLQGN
GNGGITPTGAFDPFVTTPTAMTPGAVGPVSANPYSHDHTGAMGGAFFANQTGFQQPIQYHLYAPIGPHSQNTLGY
QRNVHDLFIPNDLREELQKKSAATLQTLPNTQLPAQVDYFHSLVPLDLSHQKNAAIFGYPSWIYKAQSSKDGIYY
ALRRLEGYRLTNERAIRSVQAWKRICNASVVTIHDAFTSRSFQDSSLIFVTDYHPLSKTLADQHLSAGTRFPGRQ
TNAHIPEQILWGYMTQIANGLKAIHANGLAARVLEPSKVLLTAKTRVRINACAILDVVQFDTQRTMADLQRQDLV
NFGQMIVTLGANSPTVIHNPTKAMEHFTRAYSPQLKSSVFWLLNSLQKDQERSIDTFITGISSQLMSTFDSALHL
DDQLNSDLGRELENARLVRLMAKLGFVNERPEYELDQRWSESGERYFLKLFRDYVFHSVDGQGDPAVDLGHVLTC
LNKLDAGTDEKIHLVSRDEQSSFIVSYKEVKKALESSFQALMKPARRMH*
Coding >Pro_DTO377G3_2|g5914.t1
ATGGCGTCTGCCGGAAAGCCTCCATTGGAGGATGCTCGTCGGACGACAGGATCACCGAAAATGAAGAGCCGTGAG
AATGCGAAAGACACATTGTGCCGTAATGTGACCATCTATGGGCGATGCCGCTATGAAGACAAAGGCTGTGCTTTC
AATCATGACCCGTCGAAGCTCAATGCAAATCAGTCGGATAGCAAGAAGCGGTTCAATGTCGACTCACCTAGCTTC
ACTCCATCCTTGCTGTCTGGGAATGGTGTATCAGCACCAAAAAAGTCCACAGCTATATCTCCCAAAGCTGCCAGT
GCAGCTCCTTTTCAACCTCGAACAACCTCATCACGTTCAAACACGAGTACACCAACAACACGGTCAGAAGCAGTG
CAAGACTGGGCGGTGGCCGATGTACAGGAATTTATTCCCCAGGGATTTGAGCACGTGACGCCTCTTCAGGGTAAT
GGAAACGGAGGCATCACCCCCACGGGTGCATTTGATCCTTTTGTTACTACCCCAACTGCCATGACTCCCGGTGCC
GTTGGCCCTGTTTCTGCCAATCCTTACTCCCACGACCATACTGGCGCCATGGGAGGTGCTTTCTTTGCAAACCAA
ACTGGATTCCAGCAGCCGATCCAGTACCATCTTTATGCCCCAATTGGCCCTCACAGCCAGAACACATTGGGATAC
CAGCGCAACGTTCATGATCTTTTTATTCCTAACGACTTGCGTGAAGAACTGCAGAAGAAATCTGCAGCTACTTTA
CAAACTCTCCCTAACACCCAACTCCCTGCCCAGGTCGACTACTTCCATTCCCTCGTCCCTCTAGATCTCAGTCAT
CAGAAGAATGCTGCAATCTTTGGCTACCCGAGCTGGATCTACAAGGCCCAGTCTAGCAAAGATGGCATCTATTAT
GCTCTTCGCAGACTTGAGGGTTATCGCTTGACCAATGAGAGGGCTATCCGTTCCGTGCAAGCCTGGAAGCGTATC
TGCAACGCCAGTGTTGTGACCATTCACGATGCGTTCACCAGCCGCAGCTTCCAAGACAGTTCTTTGATCTTTGTG
ACCGACTATCACCCACTGTCCAAGACCCTTGCGGACCAGCATCTCAGCGCTGGAACCCGCTTCCCAGGCCGTCAG
ACCAATGCTCATATTCCTGAGCAGATTCTCTGGGGCTACATGACCCAGATCGCCAATGGACTCAAGGCGATCCAC
GCCAATGGTCTTGCTGCCCGAGTGCTCGAGCCTAGCAAGGTTTTGCTTACTGCTAAGACCCGTGTCCGCATCAAC
GCCTGCGCTATTCTTGATGTGGTGCAATTCGATACCCAGCGGACTATGGCTGACCTCCAGCGACAAGATCTGGTC
AACTTCGGCCAAATGATCGTCACCCTTGGCGCCAACTCACCCACTGTCATCCACAACCCAACCAAGGCCATGGAG
CATTTCACTCGCGCCTACAGCCCGCAGTTGAAGAGCTCTGTGTTCTGGCTGTTGAACAGTCTGCAGAAGGATCAG
GAGCGAAGCATCGACACTTTTATCACTGGCATCTCATCCCAGCTGATGTCAACTTTTGATTCGGCACTCCACCTC
GATGATCAGCTGAACTCTGATCTCGGCCGTGAGTTGGAGAATGCACGACTTGTGCGCCTGATGGCCAAACTCGGG
TTCGTCAATGAACGCCCTGAGTATGAACTTGACCAGCGCTGGTCGGAGAGCGGCGAACGCTACTTCCTAAAGCTT
TTCCGCGATTACGTCTTCCACTCGGTGGATGGCCAAGGTGATCCGGCGGTTGATCTTGGCCATGTCTTGACTTGC
TTGAACAAGCTCGATGCGGGAACTGACGAAAAGATCCATCTAGTCAGTCGCGACGAGCAGAGTTCCTTCATTGTC
AGCTACAAGGAGGTTAAGAAGGCTCTTGAGTCTTCCTTCCAGGCTCTGATGAAGCCTGCTAGACGCATGCACTAG
Transcript >Pro_DTO377G3_2|g5914.t1
ATGGCGTCTGCCGGAAAGCCTCCATTGGAGGATGCTCGTCGGACGACAGGATCACCGAAAATGAAGAGCCGTGAG
AATGCGAAAGACACATTGTGCCGTAATGTGACCATCTATGGGCGATGCCGCTATGAAGACAAAGGCTGTGCTTTC
AATCATGACCCGTCGAAGCTCAATGCAAATCAGTCGGATAGCAAGAAGCGGTTCAATGTCGACTCACCTAGCTTC
ACTCCATCCTTGCTGTCTGGGAATGGTGTATCAGCACCAAAAAAGTCCACAGCTATATCTCCCAAAGCTGCCAGT
GCAGCTCCTTTTCAACCTCGAACAACCTCATCACGTTCAAACACGAGTACACCAACAACACGGTCAGAAGCAGTG
CAAGACTGGGCGGTGGCCGATGTACAGGAATTTATTCCCCAGGGATTTGAGCACGTGACGCCTCTTCAGGGTAAT
GGAAACGGAGGCATCACCCCCACGGGTGCATTTGATCCTTTTGTTACTACCCCAACTGCCATGACTCCCGGTGCC
GTTGGCCCTGTTTCTGCCAATCCTTACTCCCACGACCATACTGGCGCCATGGGAGGTGCTTTCTTTGCAAACCAA
ACTGGATTCCAGCAGCCGATCCAGTACCATCTTTATGCCCCAATTGGCCCTCACAGCCAGAACACATTGGGATAC
CAGCGCAACGTTCATGATCTTTTTATTCCTAACGACTTGCGTGAAGAACTGCAGAAGAAATCTGCAGCTACTTTA
CAAACTCTCCCTAACACCCAACTCCCTGCCCAGGTCGACTACTTCCATTCCCTCGTCCCTCTAGATCTCAGTCAT
CAGAAGAATGCTGCAATCTTTGGCTACCCGAGCTGGATCTACAAGGCCCAGTCTAGCAAAGATGGCATCTATTAT
GCTCTTCGCAGACTTGAGGGTTATCGCTTGACCAATGAGAGGGCTATCCGTTCCGTGCAAGCCTGGAAGCGTATC
TGCAACGCCAGTGTTGTGACCATTCACGATGCGTTCACCAGCCGCAGCTTCCAAGACAGTTCTTTGATCTTTGTG
ACCGACTATCACCCACTGTCCAAGACCCTTGCGGACCAGCATCTCAGCGCTGGAACCCGCTTCCCAGGCCGTCAG
ACCAATGCTCATATTCCTGAGCAGATTCTCTGGGGCTACATGACCCAGATCGCCAATGGACTCAAGGCGATCCAC
GCCAATGGTCTTGCTGCCCGAGTGCTCGAGCCTAGCAAGGTTTTGCTTACTGCTAAGACCCGTGTCCGCATCAAC
GCCTGCGCTATTCTTGATGTGGTGCAATTCGATACCCAGCGGACTATGGCTGACCTCCAGCGACAAGATCTGGTC
AACTTCGGCCAAATGATCGTCACCCTTGGCGCCAACTCACCCACTGTCATCCACAACCCAACCAAGGCCATGGAG
CATTTCACTCGCGCCTACAGCCCGCAGTTGAAGAGCTCTGTGTTCTGGCTGTTGAACAGTCTGCAGAAGGATCAG
GAGCGAAGCATCGACACTTTTATCACTGGCATCTCATCCCAGCTGATGTCAACTTTTGATTCGGCACTCCACCTC
GATGATCAGCTGAACTCTGATCTCGGCCGTGAGTTGGAGAATGCACGACTTGTGCGCCTGATGGCCAAACTCGGG
TTCGTCAATGAACGCCCTGAGTATGAACTTGACCAGCGCTGGTCGGAGAGCGGCGAACGCTACTTCCTAAAGCTT
TTCCGCGATTACGTCTTCCACTCGGTGGATGGCCAAGGTGATCCGGCGGTTGATCTTGGCCATGTCTTGACTTGC
TTGAACAAGCTCGATGCGGGAACTGACGAAAAGATCCATCTAGTCAGTCGCGACGAGCAGAGTTCCTTCATTGTC
AGCTACAAGGAGGTTAAGAAGGCTCTTGAGTCTTCCTTCCAGGCTCTGATGAAGCCTGCTAGACGCATGCACTAG
Gene >Pro_DTO377G3_2|g5914.t1
ATGGCGTCTGCCGGAAAGCCTCCATTGGAGGATGCTCGTCGGACGACAGGATCACCGAAAATGAAGAGCCGTGGT
GAGTGTGATTCGAAGTCAAGGCTGGCATTTCAGTTCCATTTTAGGACTGAGATGGGCAAGCTGGAGGTGGATGAA
TTCGAGATGGACCGAGTTGCTGATAACAATGATTTTGCCCGATAGAGAATGCGAAAGACACATTGTGCCGTAATG
TGACCATCTATGGGCGATGCCGCTATGAAGACAAAGGTATTGCGAACCTGAATCACGGCCAGCGTGGGTGGTGAA
GCTGATTTGGAACTTTTGTATCCAGGCTGTGCTTTCAATCATGACCCGTCGAAGCTCAATGCAAATCAGTCGGAT
AGGTGCGATGAACACTTGGTCTCTATACGACAACTGGATATATTTTGCTAACAAGGACTGTTTCGTTTGATAGCA
AGAAGCGGTTCAATGTCGACTCACCTAGCTTCACTCCATCCTTGCTGTCTGGGAATGGTGTATCAGCACCAAAAA
AGTCCACAGCTATATCTCCCAAAGCTGCCAGTGCAGCTCCTTTTCAACCTCGAACAACCTCATCACGTATGTGCT
CCATGTGGAGAGGGAGGGAGGTTCCAAAAGCATTCACTGACGTCAGAAAAAGGTTCAAACACGAGTACACCAACA
ACACGGTCAGAAGCAGTGCAAGACTGGGCGGTGGCCGATGTACAGGAATTTATTCCCCAGGGATTTGAGCACGTG
GTCAGTCGTCCCTGCCCTTATCACTCGATTCGCATCGATTTCCTCCCCTCTACCTCTTGTCTTCTTACCCATCCC
TCTTTACCTGCACTAGCCCTATTGTTATCATCATCTCTATCATCACGATGGTGCTAGGTGGCTTGTCTGCCATGG
CATCTGAATTCGATCCTGAATCTTCTGATTCTCCCCGATACTTCACCTCTCATCCGCCTCAGCCTGAAAGCCCTG
GGTGGTTCAACAGTATTCTGAGCAATCGTGCTAATTTTCCTACTCAGACGCCTCTTCAGGGTAATGGAAACGGAG
GCATCACCCCCACGGGTGCATTTGATCCTTTTGTTACTACCCCAACTGCCATGACTCCCGGTGCCGTTGGCCCTG
TTTCTGCCAATCCTTACTCCCACGACCATACTGGCGCCATGGGAGGTGCTTTCTTTGCAAACCAAACTGGATTCC
AGCAGCCGGTACGTTGGTTTCCATTGGATCCTCTTTGTTTCTTTGACTGATCTCCAACTGCCCAACAGATCCAGT
ACCATCTTTATGCCCCAATTGGCCCTCACAGCCAGAACACATTGGGATACCAGCGCAACGTTCATGATCTTTTTA
TTCCTAACGACTTGCGTGAAGAACTGCAGAAGAAATCTGCAGCTACTTTACAAACTCTCCCTAGTATGTTAGACA
TCACCCAATAATAATTTTTTACTCATGCTGACAAACTTGAAGACACCCAACTCCCTGCCCAGGTCGACTACTTCC
ATTCCCTCGTCCCTCTAGATCTCAGTCATCAGAAGAATGCTGCAATCTTTGGCTACCCGAGCTGGATCTACAAGG
CCCAGTCTAGCAAAGATGGCATCTATTATGCTCTTCGCAGACTTGAGGGTATGACAATCTTCCCGTCTCTTTTGT
AGCTCCAAACTAACCGTGTAGGTTATCGCTTGACCAATGAGAGGGCTATCCGTTCCGTGCAAGCCTGGAAGCGTA
TCTGCAACGCCAGTGTTGTGACCATTCACGATGCGTTCACCAGCCGCAGCTTCCAAGACAGTTCTTTGATCTTTG
TGACCGACTATCACCCACTGTCCAAGACCCTTGCGGACCAGCATCTCAGCGCTGGAACCCGCTTCCCAGGCCGTC
AGACCAATGCTCATATTCCTGAGCAGATTCTCTGGGGCTACATGACCCAGATCGCCAATGGACTCAAGGCGATCC
ACGCCAATGGTCTTGCTGCCCGAGTGCTCGAGCCTAGCAAGGTTTTGCTTACTGCTAAGACCCGTGTCCGCATCA
ACGCCTGCGCTATTCTTGATGTGGTGCAATTCGATACCCAGCGGACTATGGCTGACCTCCAGCGACAAGATCTGG
TCAACTTCGGCCAAATGATCGTCACCCTTGGCGCCAACTCACCCACTGTCATCCACAACCCAACCAAGGCCATGG
AGCATTTCACTCGCGCCTACAGCCCGCAGTTGAAGAGCTCTGTGTTCTGGCTGTTGAACAGTCTGCAGAAGGATC
AGGAGCGAAGCATCGACACTTTTATCACTGGCATCTCATCCCAGCTGATGTCAACTTTTGATTCGGCACTCCACC
TCGATGATCAGCTGAACTCTGATCTCGGCCGTGAGTTGGAGAATGCACGACTTGTGCGCCTGATGGCCAAACTCG
GGTTCGTCAATGAACGCCCTGAGTATGAACTTGACCAGCGCTGGTCGGAGAGCGGCGAACGCTACTTCCTAAAGC
TTTTCCGCGATTACGTCTTCCACTCGGTGGATGGCCAAGGTGATCCGGCGGTTGATCTTGGCCATGTCTTGACTT
GCTTGAACAAGCTCGATGCGGGAACTGACGAAAAGATCCATCTAGTCAGTCGCGACGAGCAGAGTTCCTTCATTG
TCAGCTACAAGGAGGTTAAGAAGGCTCTTGAGTCTTCCTTCCAGGCTCTGATGAAGCCTGCTAGACGCATGCACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail