Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5913.t1
Gene name
Locationscaffold_15:134322..135955
Strand-
Gene length (bp)1633
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 2.0E-10 411 503
PF14555 UBA_4 UBA-like domain 9.9E-10 22 56

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 88.73 54.52 122.94
5d_25C Five days - 25 degrees Celsius 126.11 76.84 175.39
7d_25C Seven days - 25 degrees Celsius 157.89 95.23 220.54
10d_25C Ten days - 25 degrees Celsius 257.15 151.14 363.17
7d_15C Seven days - 15 degrees Celsius 120.97 73.64 168.31
7d_30C Seven days - 30 degrees Celsius 131.40 79.96 182.84

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.099168 no
3d_25C 7d_25C 0.004840 yes
3d_25C 7d_15C 0.158075 no
3d_25C 7d_30C 0.056008 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.359461 no
5d_25C 7d_15C 0.899619 no
5d_25C 7d_30C 0.899421 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.248473 no
7d_25C 7d_30C 0.463135 no
7d_25C 10d_25C 0.027043 yes
7d_15C 7d_30C 0.778720 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5913.t1
MSQPEVDLDGLSDSEKSTLEMYMAVTSQEPSEAIPLLRRSQWNVQIAISKFFDGEGPDPVEEARAALDRPPPPQP
NRRTQNLMTDDLTEHLSQVARATATDLAPRVNLQPADQPTYRPPFILSLLLTPFNLVYRILCSSFRLFGVLFPFL
PRLFNRTANPALQGARRNTTGRRSLGPKDTAARFIREFEEEYESIPIPFLENGYNMALEKAHRDLKYLLVILLSP
EHDDTDSWVRDTLLAPEVVEFINDPQNNLLVWGGNVRDSEAYQVANSLKCTKFPFAAVIVHTPNVSSTAMSVVGR
IAGLTTPSEVVNKLRTVVTSNSEPLERLRSSRAEQQASRSLREEQDSAYERSLAIDRERARQRREAELARQREEQ
EAADRQAAEEQRLRDLAQWKLWRGQSLSAEPGPDVKDAVRISVRLPSGERIMRKFAPDADIEEIYAVVECYEILQ
EQDTERPVVSAPEGFVHHYGFRLVSPMPRVVYAVDEGGSIREKIGRGGNLLVEPIDEDEDDADDDEVVTDMS*
Coding >Pro_DTO377G3_2|g5913.t1
ATGTCACAACCCGAGGTTGACCTGGACGGGCTTTCTGATAGCGAGAAGTCTACGCTAGAAATGTACATGGCTGTC
ACCAGTCAGGAACCTTCCGAAGCAATTCCGCTACTACGTCGGTCACAATGGAATGTGCAGATTGCCATATCCAAG
TTTTTTGATGGCGAAGGCCCAGATCCCGTTGAAGAAGCCCGCGCTGCCTTGGATCGCCCCCCTCCCCCCCAACCC
AATCGCCGAACCCAGAATTTAATGACCGACGATTTGACCGAACACTTGTCGCAAGTTGCTCGTGCCACAGCTACA
GATTTGGCGCCACGAGTTAACTTACAGCCGGCAGACCAGCCAACCTACCGACCTCCATTTATTCTTAGCCTACTT
CTCACTCCATTTAATTTGGTATACCGAATTCTTTGCAGTTCATTCCGCCTATTTGGTGTCCTCTTCCCTTTTTTG
CCACGCTTGTTTAACAGGACAGCGAACCCCGCGCTGCAAGGTGCTCGCCGGAATACCACTGGCCGTCGATCCCTC
GGTCCCAAAGATACTGCCGCTCGCTTTATCCGCGAGTTCGAAGAAGAATATGAATCTATCCCGATTCCATTCCTG
GAGAACGGATACAACATGGCGCTGGAGAAAGCCCATCGCGACTTGAAGTACCTCCTGGTCATTCTCTTATCTCCA
GAGCACGACGATACGGACAGCTGGGTCCGGGATACTCTGCTGGCACCTGAGGTCGTAGAATTCATCAATGACCCC
CAGAACAACCTCCTGGTGTGGGGCGGCAACGTGCGAGATTCCGAAGCATACCAAGTCGCCAACTCATTGAAATGC
ACCAAATTCCCCTTTGCAGCGGTCATCGTCCATACACCAAATGTTTCATCAACCGCGATGTCTGTTGTAGGACGG
ATCGCAGGTCTCACGACGCCATCCGAGGTCGTGAACAAGCTCCGGACAGTCGTGACATCTAACAGCGAGCCCCTG
GAGCGACTCCGATCTTCACGCGCGGAGCAACAAGCCTCGCGCAGCCTCCGCGAAGAGCAAGACTCAGCCTACGAG
CGGTCGCTGGCGATCGACCGTGAACGGGCGCGCCAGCGCCGGGAAGCGGAGTTGGCACGTCAACGCGAAGAACAG
GAAGCCGCTGACCGACAGGCGGCTGAAGAGCAACGGCTCCGCGATCTCGCCCAGTGGAAGCTTTGGCGCGGGCAA
TCGCTTAGCGCGGAGCCCGGGCCGGATGTCAAAGATGCCGTTCGTATTAGCGTGCGGCTCCCGTCCGGCGAGCGC
ATCATGCGTAAGTTTGCGCCAGATGCAGACATTGAAGAGATCTACGCGGTGGTTGAGTGCTACGAGATCTTACAG
GAGCAGGATACAGAGCGTCCTGTGGTGAGTGCGCCGGAGGGGTTTGTGCACCACTACGGATTTCGACTGGTCTCA
CCGATGCCTCGAGTAGTGTATGCTGTTGATGAGGGAGGGTCGATCAGAGAGAAGATTGGGCGTGGCGGTAATCTG
TTGGTGGAACCAATCGACGAGGATGAAGACGATGCAGATGATGACGAGGTGGTGACCGACATGTCTTGA
Transcript >Pro_DTO377G3_2|g5913.t1
ATGTCACAACCCGAGGTTGACCTGGACGGGCTTTCTGATAGCGAGAAGTCTACGCTAGAAATGTACATGGCTGTC
ACCAGTCAGGAACCTTCCGAAGCAATTCCGCTACTACGTCGGTCACAATGGAATGTGCAGATTGCCATATCCAAG
TTTTTTGATGGCGAAGGCCCAGATCCCGTTGAAGAAGCCCGCGCTGCCTTGGATCGCCCCCCTCCCCCCCAACCC
AATCGCCGAACCCAGAATTTAATGACCGACGATTTGACCGAACACTTGTCGCAAGTTGCTCGTGCCACAGCTACA
GATTTGGCGCCACGAGTTAACTTACAGCCGGCAGACCAGCCAACCTACCGACCTCCATTTATTCTTAGCCTACTT
CTCACTCCATTTAATTTGGTATACCGAATTCTTTGCAGTTCATTCCGCCTATTTGGTGTCCTCTTCCCTTTTTTG
CCACGCTTGTTTAACAGGACAGCGAACCCCGCGCTGCAAGGTGCTCGCCGGAATACCACTGGCCGTCGATCCCTC
GGTCCCAAAGATACTGCCGCTCGCTTTATCCGCGAGTTCGAAGAAGAATATGAATCTATCCCGATTCCATTCCTG
GAGAACGGATACAACATGGCGCTGGAGAAAGCCCATCGCGACTTGAAGTACCTCCTGGTCATTCTCTTATCTCCA
GAGCACGACGATACGGACAGCTGGGTCCGGGATACTCTGCTGGCACCTGAGGTCGTAGAATTCATCAATGACCCC
CAGAACAACCTCCTGGTGTGGGGCGGCAACGTGCGAGATTCCGAAGCATACCAAGTCGCCAACTCATTGAAATGC
ACCAAATTCCCCTTTGCAGCGGTCATCGTCCATACACCAAATGTTTCATCAACCGCGATGTCTGTTGTAGGACGG
ATCGCAGGTCTCACGACGCCATCCGAGGTCGTGAACAAGCTCCGGACAGTCGTGACATCTAACAGCGAGCCCCTG
GAGCGACTCCGATCTTCACGCGCGGAGCAACAAGCCTCGCGCAGCCTCCGCGAAGAGCAAGACTCAGCCTACGAG
CGGTCGCTGGCGATCGACCGTGAACGGGCGCGCCAGCGCCGGGAAGCGGAGTTGGCACGTCAACGCGAAGAACAG
GAAGCCGCTGACCGACAGGCGGCTGAAGAGCAACGGCTCCGCGATCTCGCCCAGTGGAAGCTTTGGCGCGGGCAA
TCGCTTAGCGCGGAGCCCGGGCCGGATGTCAAAGATGCCGTTCGTATTAGCGTGCGGCTCCCGTCCGGCGAGCGC
ATCATGCGTAAGTTTGCGCCAGATGCAGACATTGAAGAGATCTACGCGGTGGTTGAGTGCTACGAGATCTTACAG
GAGCAGGATACAGAGCGTCCTGTGGTGAGTGCGCCGGAGGGGTTTGTGCACCACTACGGATTTCGACTGGTCTCA
CCGATGCCTCGAGTAGTGTATGCTGTTGATGAGGGAGGGTCGATCAGAGAGAAGATTGGGCGTGGCGGTAATCTG
TTGGTGGAACCAATCGACGAGGATGAAGACGATGCAGATGATGACGAGGTGGTGACCGACATGTCTTGA
Gene >Pro_DTO377G3_2|g5913.t1
ATGTCACAACCCGAGGTTGACCTGGACGGGCTTTCTGATAGCGAGAAGTCTACGCTAGAAATGTACATGGCTGTC
ACCAGTCAGGAACCTTCCGAAGCAATTCCGCTACTACGTCGGTCACAATGGAATGTGCAGGTTGGTCTATCTTCC
CCGACTTCCAATCAAGCGTACGAGCGTTTAACTGATCCCCGCATGATAGATTGCCATATCCAAGTTTTTTGATGG
CGAAGGCCCAGATCCCGTTGAAGAAGCCCGCGCTGCCTTGGATCGCCCCCCTCCCCCCCAACCCAATCGCCGAAC
CCAGAATTTAATGACCGACGATTTGACCGAACACTTGTCGCAAGTTGCTCGTGCCACAGCTACAGATTTGGCGCC
ACGAGTTAACTTACAGCCGGCAGACCAGCCAACCTACCGACCTCCATTTATTCTTAGCCTACTTCTCACTCCATT
TAATTTGGTATACCGAATTCTTTGCAGTTCATTCCGCCTATTTGGTGTCCTCTTCCCTTTTTTGCCACGCTTGTT
TAACAGGACAGCGAACCCCGCGCTGCAAGGTGCTCGCCGGAATACCACTGGCCGTCGATCCCTCGGTCCCAAAGA
TACTGCCGCTCGCTTTATCCGCGAGTTCGAAGAAGAATATGAATCTATCCCGATTCCATTCCTGGAGAACGGATA
CAACATGGCGCTGGAGAAAGCCCATCGCGACTTGAAGTACCTCCTGGTCATTCTCTTATCTCCAGAGCACGACGA
TACGGACAGCTGGGTCCGGGATACTCTGCTGGCACCTGAGGTCGTAGAATTCATCAATGACCCCCAGAACAACCT
CCTGGTGTGGGGCGGCAACGTGCGAGATTCCGAAGCATACCAAGTCGCCAACTCATTGAAATGCACCAAATTCCC
CTTTGCAGCGGTCATCGTCCATACACCAAATGTTTCATCAACCGCGATGTCTGTTGTAGGACGGATCGCAGGTCT
CACGACGCCATCCGAGGTCGTGAACAAGCTCCGGACAGTCGTGACATCTAACAGCGAGCCCCTGGAGCGACTCCG
ATCTTCACGCGCGGAGCAACAAGCCTCGCGCAGCCTCCGCGAAGAGCAAGACTCAGCCTACGAGCGGTCGCTGGC
GATCGACCGTGAACGGGCGCGCCAGCGCCGGGAAGCGGAGTTGGCACGTCAACGCGAAGAACAGGAAGCCGCTGA
CCGACAGGCGGCTGAAGAGCAACGGCTCCGCGATCTCGCCCAGTGGAAGCTTTGGCGCGGGCAATCGCTTAGCGC
GGAGCCCGGGCCGGATGTCAAAGATGCCGTTCGTATTAGCGTGCGGCTCCCGTCCGGCGAGCGCATCATGCGTAA
GTTTGCGCCAGATGCAGACATTGAAGAGATCTACGCGGTGGTTGAGTGCTACGAGATCTTACAGGAGCAGGATAC
AGAGCGTCCTGTGGTGAGTGCGCCGGAGGGGTTTGTGCACCACTACGGATTTCGACTGGTCTCACCGATGCCTCG
AGTAGTGTATGCTGTTGATGAGGGAGGGTCGATCAGAGAGAAGATTGGGCGTGGCGGTAATCTGTTGGTGGAACC
AATCGACGAGGATGAAGACGATGCAGATGATGACGAGGTGGTGACCGACATGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail