Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5912.t1
Gene name
Locationscaffold_15:128600..133079
Strand-
Gene length (bp)4479
Transcript length (bp)4479
Coding sequence length (bp)4479
Protein length (aa) 1493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.0E-39 494 704
PF01061 ABC2_membrane ABC-2 type transporter 2.9E-49 1168 1381
PF00005 ABC_tran ABC transporter 2.4E-16 172 328
PF00005 ABC_tran ABC transporter 1.4E-18 866 1017
PF06422 PDR_CDR CDR ABC transporter 7.9E-32 717 807
PF14510 ABC_trans_N ABC-transporter N-terminal 3.4E-19 58 145

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016887 ATPase activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0016462 pyrophosphatase activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044425 membrane part No
GO:0005488 binding No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0042623 ATPase activity, coupled No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 513 535 22
2 547 569 22
3 589 611 22
4 624 646 22
5 656 675 19
6 766 788 22
7 1184 1206 22
8 1219 1241 22
9 1261 1283 22
10 1304 1326 22
11 1336 1355 19
12 1362 1384 22
13 1457 1479 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5912.t1
MSLLGTLNPSTQDGEDSHSANMEARRHDPTASVSTDDTANEKGEIGNEDYTEAEVTRLARQLTRQSTHFSVSTQN
AENPFVEVHEDSTLNPHSENFNPKNWMKNLLAIQSRDPERYPKRQAGLAFRNLSVHGFGSPTDYQKDVANSILQI
GAVFRAMTGTGKQKIQILRDFDGLVKSGEMLVVLGRPGSGCSTFLKTIAGDLNGIFKDGNSHMNYQGISDKQMHS
QFRGEAIYTAETDVHFPQLSVGNTLKFAALARAPRNRLPGVTRDQYAEHMRDVVMAMLGLSHTINTQVGNDFIRG
VSGGERKRVSIAEATLCGSPLQCWDNSTRGLDSANALEFCKTLNLMSKYSGTTCAVAIYQASQSAYDVFDKVTVL
YEGRQIYFGRTTEAKEFFTNMGFECPERQTTADFLTSLTSPAERVVKPGFENVVPRTPDEFATAWKNSAAYKELL
KEIAEYDEQYPIGGESYEKFVESRKAMQSKRQRVKSPFTLSVAEQVQICVTRGFQRLKGDYSLTISALIGNTIMA
LIIGSVFFQLPGDVTSFYSRGALLFFAVLLNSFSSALEILTLYAQRPIVEKQARYAMYHPFAEAISSMLCDMPYK
ITNAFTFNITLYFMTGLRQTGGAFFTFLLFSFVTTMTMSMVFRTIASYSRTLSQALVPAAILILGLVIYTGFTIP
TRNMLGWSRWMNYIDPIAYGFETLIVNEFHGRDFPCKAGSFIPVGESYTDVGRYNKICGAKGAVAGQDYISGEAY
YTASFQYSHGHKWRNLGIMIGFMIFFMCTYLIGTEYISESKSKGEVLLFRRGYAPKKVGSSEDDVEQTHSVSPAE
KKDGASYGEETTAAIQRQTAIFQWQDVCYDIHIKKEERRILDHVDGWVKPGTCTALMGVSGAGKTTLLDVLATRV
TMGVVSGEMLVDGRPCDHSFQRKTGYVQQQDLHLHTTTVREALRFSAILRQPRHVSRQEKLDYVEEVIKLLGMEH
YADAVVGVPGEGLNVEQRKRLTIGVELAARPQLLLFLDEPTSGLDSQTSWSILDLIDTLTKHGQAILCTIHQPSA
MLFQRFDRLLFLARGGRTVYFGEIGEKSSTLSNYFERNGAPKLSPEANPAEWMLEVIGAAPGTHSEIDWPAVWRD
SPERKEVQNHLAELKSSLSLKPVATTDNDPTSFHEFAAPFSVQLWQCLLRVFSQYWRTPVYIYSKIALCTLTALY
VGFSFFHAQNSIQGLQNQMFSVFMLMTVFGNLVQQIMPHFVTQRSLYEVRERPSKSYSWQAFMSANIIVELPWNA
LMSVLIFVCWYYPIGLQRNTSADDLHERGALMWLLVLTFMIFTCTFAHMMIAGIELAETGGNIANLLFSLCLIFC
GVLATPDQMPRFWIFMYRLSPFTYLVSAMLSTGTSGTNVVCEPVEMLHFEPLAGDTCYQYMSAYMEVAGGYLQNA
NATSDCSFCSVDKTDTFLKGVLSYYSDAWRNFGIMWAYIIFNIFAAVGIYWLARVPKGTRSKKTKTA*
Coding >Pro_DTO377G3_2|g5912.t1
ATGTCGCTCCTAGGGACATTGAATCCCAGCACCCAGGACGGAGAGGATTCCCATTCCGCCAACATGGAAGCTCGC
CGCCATGACCCCACCGCCAGCGTGAGCACCGATGACACCGCTAATGAGAAGGGCGAGATTGGCAACGAGGACTAC
ACCGAGGCCGAGGTCACTCGCCTGGCCCGGCAACTCACCCGCCAGTCAACACACTTCTCTGTCTCAACCCAGAAT
GCGGAGAACCCTTTCGTCGAAGTCCATGAGGACTCAACCCTCAATCCTCACAGTGAGAATTTCAACCCCAAGAAT
TGGATGAAGAATCTCCTTGCCATCCAATCTCGCGACCCGGAACGATACCCGAAGCGTCAGGCGGGCCTGGCCTTC
AGAAACCTCAGTGTGCACGGATTTGGCAGCCCCACCGATTACCAAAAGGATGTGGCCAACTCCATTCTGCAAATC
GGCGCCGTGTTCCGTGCGATGACCGGCACTGGCAAGCAGAAGATTCAGATCCTCCGCGACTTCGATGGCCTCGTT
AAGAGCGGCGAGATGCTGGTCGTTCTCGGCCGTCCTGGATCTGGCTGTTCGACTTTCTTGAAGACTATTGCAGGA
GACTTGAACGGCATCTTCAAGGATGGTAACTCTCATATGAACTACCAAGGAATCTCCGACAAGCAGATGCACAGC
CAGTTCCGCGGTGAGGCCATCTACACCGCTGAAACCGATGTGCATTTCCCTCAGCTTTCGGTTGGAAATACCTTG
AAGTTCGCTGCTCTCGCTCGCGCCCCGCGCAACCGTTTGCCGGGCGTCACTCGCGATCAATACGCAGAGCATATG
CGTGATGTCGTCATGGCTATGCTTGGTCTTTCGCACACTATCAACACCCAGGTCGGTAACGATTTCATTCGTGGT
GTCTCCGGTGGTGAGCGGAAGCGTGTCAGTATCGCCGAGGCCACCCTCTGCGGCAGCCCTCTCCAATGCTGGGAT
AACAGTACTCGTGGTTTGGACAGTGCCAATGCTCTGGAGTTCTGTAAGACATTGAACTTGATGTCTAAGTACTCG
GGCACTACCTGTGCCGTTGCTATCTACCAGGCATCCCAGAGTGCCTACGATGTTTTCGACAAAGTGACTGTGCTA
TACGAGGGCCGACAGATCTACTTCGGCCGTACCACCGAGGCCAAGGAATTCTTCACCAACATGGGCTTCGAGTGT
CCCGAGCGCCAGACTACCGCTGATTTCCTGACCTCGCTTACGAGCCCCGCTGAGCGAGTCGTCAAACCTGGCTTT
GAGAACGTCGTTCCCCGTACCCCCGATGAGTTCGCCACTGCTTGGAAAAACAGTGCTGCGTACAAGGAGCTTCTG
AAGGAGATTGCCGAGTACGATGAGCAGTATCCCATTGGCGGCGAGTCCTACGAGAAATTCGTCGAGTCTCGCAAG
GCTATGCAGTCGAAGAGGCAGCGTGTCAAGTCTCCATTCACCCTATCAGTCGCCGAGCAGGTCCAAATCTGTGTG
ACCCGTGGTTTCCAGCGTTTGAAGGGTGACTACAGTCTGACTATATCCGCCTTGATTGGAAACACCATTATGGCA
TTGATTATTGGTTCGGTCTTCTTCCAGTTGCCTGGCGACGTGACCAGTTTCTACTCTCGCGGTGCCCTTCTCTTC
TTCGCCGTTCTTCTCAACTCGTTCTCCAGTGCTCTAGAGATTCTCACTCTCTACGCGCAACGTCCTATTGTCGAA
AAGCAAGCCCGTTACGCTATGTATCATCCGTTTGCCGAAGCAATCTCGTCAATGCTGTGTGATATGCCGTACAAA
ATCACCAATGCCTTCACCTTCAACATCACACTCTATTTCATGACTGGTCTTCGCCAAACCGGCGGCGCTTTCTTC
ACCTTTCTGCTCTTCTCTTTCGTGACGACCATGACCATGTCCATGGTCTTCCGTACCATCGCTTCTTACTCGCGT
ACTTTGTCGCAGGCTCTAGTGCCCGCCGCCATCCTGATTCTCGGTCTGGTAATCTACACTGGCTTCACTATACCA
ACCCGCAACATGCTTGGCTGGTCTCGCTGGATGAACTACATTGACCCGATTGCTTATGGTTTCGAAACCTTGATC
GTGAACGAATTCCACGGTCGCGATTTCCCATGCAAAGCGGGTTCTTTCATCCCGGTGGGTGAATCCTACACGGAT
GTCGGTCGGTACAACAAGATCTGCGGAGCGAAAGGAGCTGTGGCTGGCCAGGACTATATCAGCGGCGAGGCCTAC
TACACTGCAAGCTTCCAGTACTCTCACGGCCACAAGTGGAGAAATCTGGGAATCATGATTGGTTTCATGATTTTC
TTCATGTGCACCTACCTCATCGGCACCGAATACATTTCCGAGTCCAAGTCCAAGGGTGAGGTTCTGCTTTTCCGT
CGCGGCTACGCCCCCAAGAAGGTCGGCAGCTCTGAAGATGATGTCGAGCAAACACACAGCGTGTCCCCTGCCGAG
AAGAAGGATGGCGCTAGCTACGGCGAAGAAACCACTGCCGCAATCCAGAGACAAACTGCTATCTTCCAATGGCAA
GACGTGTGTTACGACATCCACATCAAGAAAGAGGAACGTCGCATTCTCGACCACGTTGACGGCTGGGTTAAGCCC
GGTACCTGCACTGCTCTCATGGGTGTTTCTGGAGCCGGTAAAACCACTCTCTTGGATGTGCTTGCTACGCGCGTG
ACAATGGGGGTTGTTTCTGGTGAAATGTTGGTTGATGGCCGTCCTTGCGACCACTCCTTCCAACGTAAGACTGGC
TATGTCCAACAGCAGGATCTCCATCTCCACACTACCACGGTCCGCGAAGCTCTTCGCTTCAGTGCTATTCTCCGT
CAACCGCGTCACGTCTCTCGCCAGGAAAAACTCGACTACGTCGAGGAAGTGATCAAGCTTCTTGGAATGGAACAC
TATGCGGATGCCGTAGTCGGTGTCCCCGGTGAAGGTTTGAATGTTGAGCAGCGCAAGCGTCTTACTATTGGTGTT
GAGCTAGCTGCCAGGCCACAACTGCTTTTATTCCTGGACGAGCCTACTTCCGGTCTTGACAGTCAAACTTCTTGG
TCTATCTTGGATCTCATTGATACCTTGACTAAGCACGGTCAGGCTATTCTCTGCACTATTCACCAGCCGTCTGCT
ATGCTCTTCCAGCGATTTGACCGTCTCCTATTCCTCGCCAGGGGCGGTAGGACTGTCTATTTCGGAGAAATTGGC
GAAAAATCTTCTACGCTCTCTAACTACTTTGAACGAAATGGTGCGCCCAAGCTGTCGCCTGAAGCCAATCCTGCC
GAATGGATGCTTGAGGTCATTGGAGCTGCCCCCGGAACCCACAGTGAGATCGACTGGCCTGCCGTGTGGCGCGAT
AGCCCTGAGCGCAAGGAAGTGCAAAATCACCTCGCCGAGCTTAAGTCCAGCCTCTCTCTGAAACCCGTTGCCACA
ACCGACAACGATCCTACCAGCTTCCACGAATTCGCCGCACCGTTCAGTGTTCAACTCTGGCAGTGTCTCCTCCGC
GTGTTCAGCCAGTACTGGCGAACTCCAGTCTACATCTATTCCAAGATTGCGCTATGTACCTTGACTGCGCTCTAC
GTCGGCTTCTCCTTCTTCCACGCCCAGAACAGTATACAAGGACTGCAGAATCAAATGTTCAGTGTCTTCATGTTG
ATGACAGTCTTCGGCAACTTGGTGCAACAGATCATGCCGCACTTTGTCACCCAACGCTCCCTCTACGAAGTCCGT
GAACGCCCCTCCAAATCATACTCCTGGCAAGCCTTTATGTCCGCAAACATCATTGTCGAACTCCCCTGGAACGCC
CTCATGTCGGTCCTCATCTTCGTCTGCTGGTACTACCCCATTGGACTGCAACGCAACACCAGCGCCGATGATCTC
CACGAGCGCGGCGCACTGATGTGGCTTCTCGTCTTGACCTTCATGATCTTCACCTGCACCTTCGCCCACATGATG
ATTGCTGGTATCGAGCTAGCCGAAACAGGTGGCAATATCGCCAACTTGCTATTCTCCCTCTGTCTGATCTTCTGT
GGTGTCCTCGCGACCCCGGACCAAATGCCCCGCTTCTGGATCTTCATGTACCGCCTCTCACCATTCACCTACCTC
GTCTCCGCAATGCTGTCGACCGGCACATCCGGCACAAACGTCGTCTGCGAGCCCGTCGAGATGCTCCACTTCGAG
CCCCTTGCCGGCGATACCTGTTACCAATACATGAGCGCCTACATGGAAGTTGCTGGTGGCTACCTCCAGAACGCG
AATGCCACTAGCGATTGCAGTTTCTGCAGCGTCGACAAGACCGATACTTTCCTCAAGGGCGTGCTGAGTTACTAC
AGCGACGCATGGCGCAACTTCGGCATCATGTGGGCGTACATCATCTTCAACATATTTGCTGCTGTTGGTATCTAC
TGGCTTGCTCGTGTGCCCAAGGGAACCCGCAGCAAGAAGACTAAGACTGCTTGA
Transcript >Pro_DTO377G3_2|g5912.t1
ATGTCGCTCCTAGGGACATTGAATCCCAGCACCCAGGACGGAGAGGATTCCCATTCCGCCAACATGGAAGCTCGC
CGCCATGACCCCACCGCCAGCGTGAGCACCGATGACACCGCTAATGAGAAGGGCGAGATTGGCAACGAGGACTAC
ACCGAGGCCGAGGTCACTCGCCTGGCCCGGCAACTCACCCGCCAGTCAACACACTTCTCTGTCTCAACCCAGAAT
GCGGAGAACCCTTTCGTCGAAGTCCATGAGGACTCAACCCTCAATCCTCACAGTGAGAATTTCAACCCCAAGAAT
TGGATGAAGAATCTCCTTGCCATCCAATCTCGCGACCCGGAACGATACCCGAAGCGTCAGGCGGGCCTGGCCTTC
AGAAACCTCAGTGTGCACGGATTTGGCAGCCCCACCGATTACCAAAAGGATGTGGCCAACTCCATTCTGCAAATC
GGCGCCGTGTTCCGTGCGATGACCGGCACTGGCAAGCAGAAGATTCAGATCCTCCGCGACTTCGATGGCCTCGTT
AAGAGCGGCGAGATGCTGGTCGTTCTCGGCCGTCCTGGATCTGGCTGTTCGACTTTCTTGAAGACTATTGCAGGA
GACTTGAACGGCATCTTCAAGGATGGTAACTCTCATATGAACTACCAAGGAATCTCCGACAAGCAGATGCACAGC
CAGTTCCGCGGTGAGGCCATCTACACCGCTGAAACCGATGTGCATTTCCCTCAGCTTTCGGTTGGAAATACCTTG
AAGTTCGCTGCTCTCGCTCGCGCCCCGCGCAACCGTTTGCCGGGCGTCACTCGCGATCAATACGCAGAGCATATG
CGTGATGTCGTCATGGCTATGCTTGGTCTTTCGCACACTATCAACACCCAGGTCGGTAACGATTTCATTCGTGGT
GTCTCCGGTGGTGAGCGGAAGCGTGTCAGTATCGCCGAGGCCACCCTCTGCGGCAGCCCTCTCCAATGCTGGGAT
AACAGTACTCGTGGTTTGGACAGTGCCAATGCTCTGGAGTTCTGTAAGACATTGAACTTGATGTCTAAGTACTCG
GGCACTACCTGTGCCGTTGCTATCTACCAGGCATCCCAGAGTGCCTACGATGTTTTCGACAAAGTGACTGTGCTA
TACGAGGGCCGACAGATCTACTTCGGCCGTACCACCGAGGCCAAGGAATTCTTCACCAACATGGGCTTCGAGTGT
CCCGAGCGCCAGACTACCGCTGATTTCCTGACCTCGCTTACGAGCCCCGCTGAGCGAGTCGTCAAACCTGGCTTT
GAGAACGTCGTTCCCCGTACCCCCGATGAGTTCGCCACTGCTTGGAAAAACAGTGCTGCGTACAAGGAGCTTCTG
AAGGAGATTGCCGAGTACGATGAGCAGTATCCCATTGGCGGCGAGTCCTACGAGAAATTCGTCGAGTCTCGCAAG
GCTATGCAGTCGAAGAGGCAGCGTGTCAAGTCTCCATTCACCCTATCAGTCGCCGAGCAGGTCCAAATCTGTGTG
ACCCGTGGTTTCCAGCGTTTGAAGGGTGACTACAGTCTGACTATATCCGCCTTGATTGGAAACACCATTATGGCA
TTGATTATTGGTTCGGTCTTCTTCCAGTTGCCTGGCGACGTGACCAGTTTCTACTCTCGCGGTGCCCTTCTCTTC
TTCGCCGTTCTTCTCAACTCGTTCTCCAGTGCTCTAGAGATTCTCACTCTCTACGCGCAACGTCCTATTGTCGAA
AAGCAAGCCCGTTACGCTATGTATCATCCGTTTGCCGAAGCAATCTCGTCAATGCTGTGTGATATGCCGTACAAA
ATCACCAATGCCTTCACCTTCAACATCACACTCTATTTCATGACTGGTCTTCGCCAAACCGGCGGCGCTTTCTTC
ACCTTTCTGCTCTTCTCTTTCGTGACGACCATGACCATGTCCATGGTCTTCCGTACCATCGCTTCTTACTCGCGT
ACTTTGTCGCAGGCTCTAGTGCCCGCCGCCATCCTGATTCTCGGTCTGGTAATCTACACTGGCTTCACTATACCA
ACCCGCAACATGCTTGGCTGGTCTCGCTGGATGAACTACATTGACCCGATTGCTTATGGTTTCGAAACCTTGATC
GTGAACGAATTCCACGGTCGCGATTTCCCATGCAAAGCGGGTTCTTTCATCCCGGTGGGTGAATCCTACACGGAT
GTCGGTCGGTACAACAAGATCTGCGGAGCGAAAGGAGCTGTGGCTGGCCAGGACTATATCAGCGGCGAGGCCTAC
TACACTGCAAGCTTCCAGTACTCTCACGGCCACAAGTGGAGAAATCTGGGAATCATGATTGGTTTCATGATTTTC
TTCATGTGCACCTACCTCATCGGCACCGAATACATTTCCGAGTCCAAGTCCAAGGGTGAGGTTCTGCTTTTCCGT
CGCGGCTACGCCCCCAAGAAGGTCGGCAGCTCTGAAGATGATGTCGAGCAAACACACAGCGTGTCCCCTGCCGAG
AAGAAGGATGGCGCTAGCTACGGCGAAGAAACCACTGCCGCAATCCAGAGACAAACTGCTATCTTCCAATGGCAA
GACGTGTGTTACGACATCCACATCAAGAAAGAGGAACGTCGCATTCTCGACCACGTTGACGGCTGGGTTAAGCCC
GGTACCTGCACTGCTCTCATGGGTGTTTCTGGAGCCGGTAAAACCACTCTCTTGGATGTGCTTGCTACGCGCGTG
ACAATGGGGGTTGTTTCTGGTGAAATGTTGGTTGATGGCCGTCCTTGCGACCACTCCTTCCAACGTAAGACTGGC
TATGTCCAACAGCAGGATCTCCATCTCCACACTACCACGGTCCGCGAAGCTCTTCGCTTCAGTGCTATTCTCCGT
CAACCGCGTCACGTCTCTCGCCAGGAAAAACTCGACTACGTCGAGGAAGTGATCAAGCTTCTTGGAATGGAACAC
TATGCGGATGCCGTAGTCGGTGTCCCCGGTGAAGGTTTGAATGTTGAGCAGCGCAAGCGTCTTACTATTGGTGTT
GAGCTAGCTGCCAGGCCACAACTGCTTTTATTCCTGGACGAGCCTACTTCCGGTCTTGACAGTCAAACTTCTTGG
TCTATCTTGGATCTCATTGATACCTTGACTAAGCACGGTCAGGCTATTCTCTGCACTATTCACCAGCCGTCTGCT
ATGCTCTTCCAGCGATTTGACCGTCTCCTATTCCTCGCCAGGGGCGGTAGGACTGTCTATTTCGGAGAAATTGGC
GAAAAATCTTCTACGCTCTCTAACTACTTTGAACGAAATGGTGCGCCCAAGCTGTCGCCTGAAGCCAATCCTGCC
GAATGGATGCTTGAGGTCATTGGAGCTGCCCCCGGAACCCACAGTGAGATCGACTGGCCTGCCGTGTGGCGCGAT
AGCCCTGAGCGCAAGGAAGTGCAAAATCACCTCGCCGAGCTTAAGTCCAGCCTCTCTCTGAAACCCGTTGCCACA
ACCGACAACGATCCTACCAGCTTCCACGAATTCGCCGCACCGTTCAGTGTTCAACTCTGGCAGTGTCTCCTCCGC
GTGTTCAGCCAGTACTGGCGAACTCCAGTCTACATCTATTCCAAGATTGCGCTATGTACCTTGACTGCGCTCTAC
GTCGGCTTCTCCTTCTTCCACGCCCAGAACAGTATACAAGGACTGCAGAATCAAATGTTCAGTGTCTTCATGTTG
ATGACAGTCTTCGGCAACTTGGTGCAACAGATCATGCCGCACTTTGTCACCCAACGCTCCCTCTACGAAGTCCGT
GAACGCCCCTCCAAATCATACTCCTGGCAAGCCTTTATGTCCGCAAACATCATTGTCGAACTCCCCTGGAACGCC
CTCATGTCGGTCCTCATCTTCGTCTGCTGGTACTACCCCATTGGACTGCAACGCAACACCAGCGCCGATGATCTC
CACGAGCGCGGCGCACTGATGTGGCTTCTCGTCTTGACCTTCATGATCTTCACCTGCACCTTCGCCCACATGATG
ATTGCTGGTATCGAGCTAGCCGAAACAGGTGGCAATATCGCCAACTTGCTATTCTCCCTCTGTCTGATCTTCTGT
GGTGTCCTCGCGACCCCGGACCAAATGCCCCGCTTCTGGATCTTCATGTACCGCCTCTCACCATTCACCTACCTC
GTCTCCGCAATGCTGTCGACCGGCACATCCGGCACAAACGTCGTCTGCGAGCCCGTCGAGATGCTCCACTTCGAG
CCCCTTGCCGGCGATACCTGTTACCAATACATGAGCGCCTACATGGAAGTTGCTGGTGGCTACCTCCAGAACGCG
AATGCCACTAGCGATTGCAGTTTCTGCAGCGTCGACAAGACCGATACTTTCCTCAAGGGCGTGCTGAGTTACTAC
AGCGACGCATGGCGCAACTTCGGCATCATGTGGGCGTACATCATCTTCAACATATTTGCTGCTGTTGGTATCTAC
TGGCTTGCTCGTGTGCCCAAGGGAACCCGCAGCAAGAAGACTAAGACTGCTTGA
Gene >Pro_DTO377G3_2|g5912.t1
ATGTCGCTCCTAGGGACATTGAATCCCAGCACCCAGGACGGAGAGGATTCCCATTCCGCCAACATGGAAGCTCGC
CGCCATGACCCCACCGCCAGCGTGAGCACCGATGACACCGCTAATGAGAAGGGCGAGATTGGCAACGAGGACTAC
ACCGAGGCCGAGGTCACTCGCCTGGCCCGGCAACTCACCCGCCAGTCAACACACTTCTCTGTCTCAACCCAGAAT
GCGGAGAACCCTTTCGTCGAAGTCCATGAGGACTCAACCCTCAATCCTCACAGTGAGAATTTCAACCCCAAGAAT
TGGATGAAGAATCTCCTTGCCATCCAATCTCGCGACCCGGAACGATACCCGAAGCGTCAGGCGGGCCTGGCCTTC
AGAAACCTCAGTGTGCACGGATTTGGCAGCCCCACCGATTACCAAAAGGATGTGGCCAACTCCATTCTGCAAATC
GGCGCCGTGTTCCGTGCGATGACCGGCACTGGCAAGCAGAAGATTCAGATCCTCCGCGACTTCGATGGCCTCGTT
AAGAGCGGCGAGATGCTGGTCGTTCTCGGCCGTCCTGGATCTGGCTGTTCGACTTTCTTGAAGACTATTGCAGGA
GACTTGAACGGCATCTTCAAGGATGGTAACTCTCATATGAACTACCAAGGAATCTCCGACAAGCAGATGCACAGC
CAGTTCCGCGGTGAGGCCATCTACACCGCTGAAACCGATGTGCATTTCCCTCAGCTTTCGGTTGGAAATACCTTG
AAGTTCGCTGCTCTCGCTCGCGCCCCGCGCAACCGTTTGCCGGGCGTCACTCGCGATCAATACGCAGAGCATATG
CGTGATGTCGTCATGGCTATGCTTGGTCTTTCGCACACTATCAACACCCAGGTCGGTAACGATTTCATTCGTGGT
GTCTCCGGTGGTGAGCGGAAGCGTGTCAGTATCGCCGAGGCCACCCTCTGCGGCAGCCCTCTCCAATGCTGGGAT
AACAGTACTCGTGGTTTGGACAGTGCCAATGCTCTGGAGTTCTGTAAGACATTGAACTTGATGTCTAAGTACTCG
GGCACTACCTGTGCCGTTGCTATCTACCAGGCATCCCAGAGTGCCTACGATGTTTTCGACAAAGTGACTGTGCTA
TACGAGGGCCGACAGATCTACTTCGGCCGTACCACCGAGGCCAAGGAATTCTTCACCAACATGGGCTTCGAGTGT
CCCGAGCGCCAGACTACCGCTGATTTCCTGACCTCGCTTACGAGCCCCGCTGAGCGAGTCGTCAAACCTGGCTTT
GAGAACGTCGTTCCCCGTACCCCCGATGAGTTCGCCACTGCTTGGAAAAACAGTGCTGCGTACAAGGAGCTTCTG
AAGGAGATTGCCGAGTACGATGAGCAGTATCCCATTGGCGGCGAGTCCTACGAGAAATTCGTCGAGTCTCGCAAG
GCTATGCAGTCGAAGAGGCAGCGTGTCAAGTCTCCATTCACCCTATCAGTCGCCGAGCAGGTCCAAATCTGTGTG
ACCCGTGGTTTCCAGCGTTTGAAGGGTGACTACAGTCTGACTATATCCGCCTTGATTGGAAACACCATTATGGCA
TTGATTATTGGTTCGGTCTTCTTCCAGTTGCCTGGCGACGTGACCAGTTTCTACTCTCGCGGTGCCCTTCTCTTC
TTCGCCGTTCTTCTCAACTCGTTCTCCAGTGCTCTAGAGATTCTCACTCTCTACGCGCAACGTCCTATTGTCGAA
AAGCAAGCCCGTTACGCTATGTATCATCCGTTTGCCGAAGCAATCTCGTCAATGCTGTGTGATATGCCGTACAAA
ATCACCAATGCCTTCACCTTCAACATCACACTCTATTTCATGACTGGTCTTCGCCAAACCGGCGGCGCTTTCTTC
ACCTTTCTGCTCTTCTCTTTCGTGACGACCATGACCATGTCCATGGTCTTCCGTACCATCGCTTCTTACTCGCGT
ACTTTGTCGCAGGCTCTAGTGCCCGCCGCCATCCTGATTCTCGGTCTGGTAATCTACACTGGCTTCACTATACCA
ACCCGCAACATGCTTGGCTGGTCTCGCTGGATGAACTACATTGACCCGATTGCTTATGGTTTCGAAACCTTGATC
GTGAACGAATTCCACGGTCGCGATTTCCCATGCAAAGCGGGTTCTTTCATCCCGGTGGGTGAATCCTACACGGAT
GTCGGTCGGTACAACAAGATCTGCGGAGCGAAAGGAGCTGTGGCTGGCCAGGACTATATCAGCGGCGAGGCCTAC
TACACTGCAAGCTTCCAGTACTCTCACGGCCACAAGTGGAGAAATCTGGGAATCATGATTGGTTTCATGATTTTC
TTCATGTGCACCTACCTCATCGGCACCGAATACATTTCCGAGTCCAAGTCCAAGGGTGAGGTTCTGCTTTTCCGT
CGCGGCTACGCCCCCAAGAAGGTCGGCAGCTCTGAAGATGATGTCGAGCAAACACACAGCGTGTCCCCTGCCGAG
AAGAAGGATGGCGCTAGCTACGGCGAAGAAACCACTGCCGCAATCCAGAGACAAACTGCTATCTTCCAATGGCAA
GACGTGTGTTACGACATCCACATCAAGAAAGAGGAACGTCGCATTCTCGACCACGTTGACGGCTGGGTTAAGCCC
GGTACCTGCACTGCTCTCATGGGTGTTTCTGGAGCCGGTAAAACCACTCTCTTGGATGTGCTTGCTACGCGCGTG
ACAATGGGGGTTGTTTCTGGTGAAATGTTGGTTGATGGCCGTCCTTGCGACCACTCCTTCCAACGTAAGACTGGC
TATGTCCAACAGCAGGATCTCCATCTCCACACTACCACGGTCCGCGAAGCTCTTCGCTTCAGTGCTATTCTCCGT
CAACCGCGTCACGTCTCTCGCCAGGAAAAACTCGACTACGTCGAGGAAGTGATCAAGCTTCTTGGAATGGAACAC
TATGCGGATGCCGTAGTCGGTGTCCCCGGTGAAGGTTTGAATGTTGAGCAGCGCAAGCGTCTTACTATTGGTGTT
GAGCTAGCTGCCAGGCCACAACTGCTTTTATTCCTGGACGAGCCTACTTCCGGTCTTGACAGTCAAACTTCTTGG
TCTATCTTGGATCTCATTGATACCTTGACTAAGCACGGTCAGGCTATTCTCTGCACTATTCACCAGCCGTCTGCT
ATGCTCTTCCAGCGATTTGACCGTCTCCTATTCCTCGCCAGGGGCGGTAGGACTGTCTATTTCGGAGAAATTGGC
GAAAAATCTTCTACGCTCTCTAACTACTTTGAACGAAATGGTGCGCCCAAGCTGTCGCCTGAAGCCAATCCTGCC
GAATGGATGCTTGAGGTCATTGGAGCTGCCCCCGGAACCCACAGTGAGATCGACTGGCCTGCCGTGTGGCGCGAT
AGCCCTGAGCGCAAGGAAGTGCAAAATCACCTCGCCGAGCTTAAGTCCAGCCTCTCTCTGAAACCCGTTGCCACA
ACCGACAACGATCCTACCAGCTTCCACGAATTCGCCGCACCGTTCAGTGTTCAACTCTGGCAGTGTCTCCTCCGC
GTGTTCAGCCAGTACTGGCGAACTCCAGTCTACATCTATTCCAAGATTGCGCTATGTACCTTGACTGCGCTCTAC
GTCGGCTTCTCCTTCTTCCACGCCCAGAACAGTATACAAGGACTGCAGAATCAAATGTTCAGTGTCTTCATGTTG
ATGACAGTCTTCGGCAACTTGGTGCAACAGATCATGCCGCACTTTGTCACCCAACGCTCCCTCTACGAAGTCCGT
GAACGCCCCTCCAAATCATACTCCTGGCAAGCCTTTATGTCCGCAAACATCATTGTCGAACTCCCCTGGAACGCC
CTCATGTCGGTCCTCATCTTCGTCTGCTGGTACTACCCCATTGGACTGCAACGCAACACCAGCGCCGATGATCTC
CACGAGCGCGGCGCACTGATGTGGCTTCTCGTCTTGACCTTCATGATCTTCACCTGCACCTTCGCCCACATGATG
ATTGCTGGTATCGAGCTAGCCGAAACAGGTGGCAATATCGCCAACTTGCTATTCTCCCTCTGTCTGATCTTCTGT
GGTGTCCTCGCGACCCCGGACCAAATGCCCCGCTTCTGGATCTTCATGTACCGCCTCTCACCATTCACCTACCTC
GTCTCCGCAATGCTGTCGACCGGCACATCCGGCACAAACGTCGTCTGCGAGCCCGTCGAGATGCTCCACTTCGAG
CCCCTTGCCGGCGATACCTGTTACCAATACATGAGCGCCTACATGGAAGTTGCTGGTGGCTACCTCCAGAACGCG
AATGCCACTAGCGATTGCAGTTTCTGCAGCGTCGACAAGACCGATACTTTCCTCAAGGGCGTGCTGAGTTACTAC
AGCGACGCATGGCGCAACTTCGGCATCATGTGGGCGTACATCATCTTCAACATATTTGCTGCTGTTGGTATCTAC
TGGCTTGCTCGTGTGCCCAAGGGAACCCGCAGCAAGAAGACTAAGACTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail