Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5906.t1
Gene name
Locationscaffold_15:116705..118017
Strand-
Gene length (bp)1312
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 1.3E-53 121 302
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 8.0E-19 59 333

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0055114 oxidation-reduction process Yes
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5906.t1
MATQSALLIGEITHARKEWESLSSFLTLKEFPSGTREEFIANCKAGKYDDVVVLYRSNSSTKYTGPFNAELLAVL
PKSLKYVCHNGAGYDNIDVAACTEKNIAVSSTPVAVNNATADVGIFLMIGALRQAYVPITALREGKWQGPITAGG
KQYSTTLGHDPKDKVLGILGMGGIGREMAIRAKAFGMKIQYHNRSRLSPELEAGATYVSFDELLANSDVLSLNLA
LNASTRHIIGANEFTKMKDGVVIVNTARGALIDEKALVAALDSGKVRSAGLDVYECEPEIEPGLVSNPNVMLLPH
IGTGTYETQKDMEILVLDNMRSAVEKGELITQVPEQKK*
Coding >Pro_DTO377G3_2|g5906.t1
ATGGCAACACAATCAGCTCTCCTCATTGGAGAAATCACACACGCGCGCAAGGAATGGGAGAGCCTCTCATCATTC
TTGACGTTGAAGGAATTCCCCAGCGGAACCAGAGAAGAGTTCATCGCAAACTGCAAGGCTGGCAAGTATGACGAT
GTAGTCGTCCTCTACCGGTCCAACAGCTCCACCAAGTACACCGGTCCGTTCAACGCAGAGTTGCTCGCAGTCCTG
CCTAAATCTCTCAAGTACGTCTGTCACAACGGCGCAGGATATGACAACATCGATGTTGCCGCCTGCACGGAGAAG
AACATCGCAGTGTCCAGCACCCCAGTTGCGGTCAACAACGCGACAGCCGACGTTGGCATTTTCCTGATGATCGGC
GCTCTGCGCCAGGCTTACGTGCCTATTACTGCTCTCCGGGAAGGAAAGTGGCAAGGCCCGATCACCGCAGGAGGA
AAGCAGTACAGCACTACCCTGGGCCACGACCCCAAGGACAAGGTCCTCGGAATTCTGGGCATGGGAGGCATCGGA
CGGGAAATGGCAATTCGCGCCAAGGCCTTCGGGATGAAGATCCAGTACCACAACCGGTCCCGTCTATCACCCGAG
CTGGAAGCCGGCGCGACATACGTCTCATTCGACGAGTTGCTCGCCAATTCGGACGTGCTCAGCTTGAACTTGGCC
TTGAACGCATCCACGCGCCACATCATTGGTGCTAATGAGTTCACCAAGATGAAGGATGGCGTCGTGATTGTTAAC
ACGGCCCGTGGTGCGCTAATTGATGAGAAGGCGTTGGTTGCGGCACTTGACTCTGGCAAGGTGCGCTCTGCTGGC
CTGGATGTGTATGAGTGCGAGCCGGAAATTGAGCCCGGGCTCGTTAGCAATCCTAATGTTATGTTGCTGCCGCAC
ATTGGTACTGGCACTTATGAGACTCAGAAGGATATGGAGATTCTGGTGCTGGATAACATGCGGTCGGCTGTTGAG
AAGGGTGAGCTTATTACACAGGTTCCAGAGCAGAAGAAATAG
Transcript >Pro_DTO377G3_2|g5906.t1
ATGGCAACACAATCAGCTCTCCTCATTGGAGAAATCACACACGCGCGCAAGGAATGGGAGAGCCTCTCATCATTC
TTGACGTTGAAGGAATTCCCCAGCGGAACCAGAGAAGAGTTCATCGCAAACTGCAAGGCTGGCAAGTATGACGAT
GTAGTCGTCCTCTACCGGTCCAACAGCTCCACCAAGTACACCGGTCCGTTCAACGCAGAGTTGCTCGCAGTCCTG
CCTAAATCTCTCAAGTACGTCTGTCACAACGGCGCAGGATATGACAACATCGATGTTGCCGCCTGCACGGAGAAG
AACATCGCAGTGTCCAGCACCCCAGTTGCGGTCAACAACGCGACAGCCGACGTTGGCATTTTCCTGATGATCGGC
GCTCTGCGCCAGGCTTACGTGCCTATTACTGCTCTCCGGGAAGGAAAGTGGCAAGGCCCGATCACCGCAGGAGGA
AAGCAGTACAGCACTACCCTGGGCCACGACCCCAAGGACAAGGTCCTCGGAATTCTGGGCATGGGAGGCATCGGA
CGGGAAATGGCAATTCGCGCCAAGGCCTTCGGGATGAAGATCCAGTACCACAACCGGTCCCGTCTATCACCCGAG
CTGGAAGCCGGCGCGACATACGTCTCATTCGACGAGTTGCTCGCCAATTCGGACGTGCTCAGCTTGAACTTGGCC
TTGAACGCATCCACGCGCCACATCATTGGTGCTAATGAGTTCACCAAGATGAAGGATGGCGTCGTGATTGTTAAC
ACGGCCCGTGGTGCGCTAATTGATGAGAAGGCGTTGGTTGCGGCACTTGACTCTGGCAAGGTGCGCTCTGCTGGC
CTGGATGTGTATGAGTGCGAGCCGGAAATTGAGCCCGGGCTCGTTAGCAATCCTAATGTTATGTTGCTGCCGCAC
ATTGGTACTGGCACTTATGAGACTCAGAAGGATATGGAGATTCTGGTGCTGGATAACATGCGGTCGGCTGTTGAG
AAGGGTGAGCTTATTACACAGGTTCCAGAGCAGAAGAAATAG
Gene >Pro_DTO377G3_2|g5906.t1
ATGGCAACACAATCAGCTCTCCTCATTGGAGAAATCACACACGCGCGCAAGGAATGGGAGAGCCTCTCATCATTC
TTGACGTTGAAGGTAAGTGATTCGTATTGCGCCGCGACCGAATCTTGCTCAATAGACAACTAGGAATTCCCCAGC
GGAACCAGAGAAGAGTTCATCGCAAACTGCAAGGCTGGCAAGTATGACGATGTAGTCGTCCTCTACCGGTCCAAC
AGCTCCACCAAGGTAGATACCGGCCTGACCTTTCACTTCGAGTGATCCGACTGACAACGCATAGTACACCGGTCC
GTTCAACGCAGAGTTGCTCGCAGTCCTGCCTAAATCTCTCAAGTACGTCTGTCACAACGGCGCAGGATATGACAA
CATCGATGTTGCCGCCTGCACGGAGAAGAACATCGCAGTGTCCAGCACCCCAGTTGCGGTCAACAACGCGACAGC
CGACGTTGGCATTTTCCTGATGATCGGCGCTCTGCGCCAGGCTTACGTGCCTATTACTGCTCTCCGGGAAGGTAA
GTGGCTAACCAGAGCGGAATGATATTCTTTCCCAGTAATCGGTGACTAACCATAATTCCTCCAACAGGAAAGTGG
CAAGGCCCGATCACCGCAGGAGGAAAGCAGTACAGCACTACCCTGGGCCACGACCCCAAGGACAAGGTCCTCGGA
ATTCTGGGCATGGGAGGCATCGGACGGGTATGTAGCACAGACAGTAATATACCACCTGACCACAGCTAACCATGA
GCAGGAAATGGCAATTCGCGCCAAGGCCTTCGGGATGAAGATCCAGTACCACAACCGGTCCCGTCTATCACCCGA
GCTGGAAGCCGGCGCGACATACGTCTCATTCGACGAGTTGCTCGCCAATTCGGACGTGCTCAGCTTGAACTTGGC
CTTGAACGCATCCACGCGCCACATCATTGGTGCTAATGAGTTCACCAAGATGAAGGATGGCGTCGTGATTGTTAA
CACGGCCCGTGGTGCGCTAATTGATGAGAAGGCGTTGGTTGCGGCACTTGACTCTGGCAAGGTATGTATTTGCTG
CGTTGAACATCAACTTCCATGATGGATATGCGGCTGACTGGTGGCTGTTCTATAGGTGCGCTCTGCTGGCCTGGA
TGTGTATGAGTGCGAGCCGGAAATTGAGCCCGGGCTCGTTAGCAATCCTAATGTTATGTTGCTGCCGCACATTGG
TACTGGCACTTATGAGACTCAGAAGGATATGGAGATTCTGGTGCTGGATAACATGCGGTCGGCTGTTGAGAAGGG
TGAGCTTATTACACAGGTTCCAGAGCAGAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail