Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5900.t1
Gene name
Locationscaffold_15:106152..107112
Strand-
Gene length (bp)960
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03067 LPMO_10 Lytic polysaccharide mono-oxygenase, cellulose-degrading 2.2E-11 20 189

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.41 0.00 1.02
5d_25C Five days - 25 degrees Celsius 1.32 0.00 2.66
7d_25C Seven days - 25 degrees Celsius 1.24 0.00 2.63
10d_25C Ten days - 25 degrees Celsius 1.87 0.02 3.71
7d_15C Seven days - 15 degrees Celsius 0.76 0.00 1.68
7d_30C Seven days - 30 degrees Celsius 2.02 0.18 3.86

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.143642 no
3d_25C 7d_25C 0.170472 no
3d_25C 7d_15C 0.506904 no
3d_25C 7d_30C 0.054784 no
3d_25C 10d_25C 0.062457 no
5d_25C 7d_25C 0.950750 no
5d_25C 7d_15C 0.448919 no
5d_25C 7d_30C 0.506152 no
5d_25C 10d_25C 0.627384 no
7d_25C 7d_15C 0.537615 no
7d_25C 7d_30C 0.463966 no
7d_25C 10d_25C 0.575937 no
7d_15C 7d_30C 0.122936 no
7d_15C 10d_25C 0.178029 no
7d_30C 10d_25C 0.925692 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5900.t1
MKSFTPALAFASIISLVNAHGFVTSPAAREPGTAMGAACGQQVLSNQESDKYGNIQGELQVAATQTDYNAAECDI
WLCKGYKFADNQANIQSYTAGEEVAFTVDIRAPHTGVANVSVVQTSSNTVIGSPLISWDVYASVATGVTANETSF
SVTIPDDLGSQCATAGDCVLQWYWYAESIDQTYESCIDFTLGGSGSSAVASTSSTSSTSSISSTSSSTVVAATTT
PTAAVVETPTTAAVQSTTPSITVAAQPTTSTTTVAAQPTTFATTVRQSTTSAAAQVPTTSADASATTSAVSIPTG
SAADVLSWIESLLGNLVGN*
Coding >Pro_DTO377G3_2|g5900.t1
ATGAAGTCTTTCACCCCCGCCCTGGCTTTCGCCAGTATCATCTCCTTGGTCAACGCCCATGGCTTCGTCACCAGC
CCGGCAGCCCGCGAGCCCGGTACTGCAATGGGAGCCGCGTGTGGTCAGCAAGTTCTGTCCAACCAGGAGTCCGAC
AAGTACGGCAACATCCAAGGCGAGCTACAAGTTGCCGCCACCCAGACCGACTACAACGCCGCCGAGTGTGACATC
TGGCTGTGCAAGGGCTACAAGTTCGCCGACAACCAGGCCAACATCCAGTCGTACACGGCAGGAGAGGAAGTCGCC
TTCACTGTTGATATTCGCGCCCCGCACACCGGTGTGGCCAATGTCTCTGTCGTCCAGACTTCTTCCAACACTGTC
ATTGGCAGTCCCCTAATCTCCTGGGATGTCTATGCGTCCGTAGCCACCGGCGTCACTGCCAACGAGACCAGCTTC
AGCGTCACTATCCCCGACGATCTTGGAAGCCAGTGTGCCACCGCCGGTGACTGTGTGTTGCAGTGGTACTGGTAC
GCAGAATCAATCGACCAGACCTACGAGTCGTGTATCGACTTCACTCTCGGTGGATCTGGTAGCTCGGCGGTTGCG
TCCACCTCGTCCACCTCATCAACCTCGTCGATCTCGTCGACCTCCAGCTCTACGGTGGTTGCCGCCACTACCACC
CCAACTGCTGCTGTTGTTGAAACCCCTACCACGGCCGCTGTTCAGTCTACAACGCCCTCCATCACAGTTGCTGCT
CAGCCTACTACTTCCACCACCACGGTTGCGGCCCAGCCTACTACTTTCGCCACCACTGTCCGTCAATCGACTACT
TCTGCTGCGGCGCAAGTCCCTACTACCAGCGCTGATGCCTCCGCTACTACCTCGGCCGTATCTATCCCCACTGGT
AGTGCTGCAGATGTCCTATCCTGGATTGAGTCCTTGTTGGGCAACTTGGTGGGTAATTAA
Transcript >Pro_DTO377G3_2|g5900.t1
ATGAAGTCTTTCACCCCCGCCCTGGCTTTCGCCAGTATCATCTCCTTGGTCAACGCCCATGGCTTCGTCACCAGC
CCGGCAGCCCGCGAGCCCGGTACTGCAATGGGAGCCGCGTGTGGTCAGCAAGTTCTGTCCAACCAGGAGTCCGAC
AAGTACGGCAACATCCAAGGCGAGCTACAAGTTGCCGCCACCCAGACCGACTACAACGCCGCCGAGTGTGACATC
TGGCTGTGCAAGGGCTACAAGTTCGCCGACAACCAGGCCAACATCCAGTCGTACACGGCAGGAGAGGAAGTCGCC
TTCACTGTTGATATTCGCGCCCCGCACACCGGTGTGGCCAATGTCTCTGTCGTCCAGACTTCTTCCAACACTGTC
ATTGGCAGTCCCCTAATCTCCTGGGATGTCTATGCGTCCGTAGCCACCGGCGTCACTGCCAACGAGACCAGCTTC
AGCGTCACTATCCCCGACGATCTTGGAAGCCAGTGTGCCACCGCCGGTGACTGTGTGTTGCAGTGGTACTGGTAC
GCAGAATCAATCGACCAGACCTACGAGTCGTGTATCGACTTCACTCTCGGTGGATCTGGTAGCTCGGCGGTTGCG
TCCACCTCGTCCACCTCATCAACCTCGTCGATCTCGTCGACCTCCAGCTCTACGGTGGTTGCCGCCACTACCACC
CCAACTGCTGCTGTTGTTGAAACCCCTACCACGGCCGCTGTTCAGTCTACAACGCCCTCCATCACAGTTGCTGCT
CAGCCTACTACTTCCACCACCACGGTTGCGGCCCAGCCTACTACTTTCGCCACCACTGTCCGTCAATCGACTACT
TCTGCTGCGGCGCAAGTCCCTACTACCAGCGCTGATGCCTCCGCTACTACCTCGGCCGTATCTATCCCCACTGGT
AGTGCTGCAGATGTCCTATCCTGGATTGAGTCCTTGTTGGGCAACTTGGTGGGTAATTAA
Gene >Pro_DTO377G3_2|g5900.t1
ATGAAGTCTTTCACCCCCGCCCTGGCTTTCGCCAGTATCATCTCCTTGGTCAACGCCCATGGCTTCGTCACCAGC
CCGGCAGCCCGCGAGCCCGGTACTGCAATGGGAGCCGCGTGTGGTCAGCAAGTTCTGTCCAACCAGGAGTCCGAC
AAGTACGGCAACATCCAAGGCGAGCTACAAGTTGCCGCCACCCAGACCGACTACAACGCCGCCGAGTGTGACATC
TGGCTGTGCAAGGGCTACAAGTTCGCCGACAACCAGGCCAACATCCAGTCGTACACGGCAGGAGAGGAAGTCGCC
TTCACTGTTGATATTCGCGCCCCGCACACCGGTGTGGCCAATGTCTCTGTCGTCCAGACTTCTTCCAACACTGTC
ATTGGCAGTCCCCTAATCTCCTGGGATGTCTATGCGTCCGTAGCCACCGGCGTCACTGCCAACGAGACCAGCTTC
AGCGTCACTATCCCCGACGATCTTGGAAGCCAGTGTGCCACCGCCGGTGACTGTGTGTTGCAGTGGTACTGGTAC
GCAGAATCAATCGACCAGACCTACGAGTCGTGTATCGACTTCACTCTCGGTGGATCTGGTAGCTCGGCGGTTGCG
TCCACCTCGTCCACCTCATCAACCTCGTCGATCTCGTCGACCTCCAGCTCTACGGTGGTTGCCGCCACTACCACC
CCAACTGCTGCTGTTGTTGAAACCCCTACCACGGCCGCTGTTCAGTCTACAACGCCCTCCATCACAGTTGCTGCT
CAGCCTACTACTTCCACCACCACGGTTGCGGCCCAGCCTACTACTTTCGCCACCACTGTCCGTCAATCGACTACT
TCTGCTGCGGCGCAAGTCCCTACTACCAGCGCTGATGCCTCCGCTACTACCTCGGCCGTATCTATCCCCACTGGT
AGTGCTGCAGATGTCCTATCCTGGATTGAGTCCTTGTTGGGCAACTTGGTGGGTAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail