Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5891.t1
Gene name
Locationscaffold_15:89912..90236
Strand-
Gene length (bp)324
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.30 2.25 36.35
5d_25C Five days - 25 degrees Celsius 21.15 0.12 42.18
7d_25C Seven days - 25 degrees Celsius 34.44 5.56 63.33
10d_25C Ten days - 25 degrees Celsius 11.25 0.00 23.18
7d_15C Seven days - 15 degrees Celsius 3.58 0.00 7.41
7d_30C Seven days - 30 degrees Celsius 14.33 0.00 28.77

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.909685 no
3d_25C 7d_25C 0.251494 no
3d_25C 7d_15C 0.036724 yes
3d_25C 7d_30C 0.642976 no
3d_25C 10d_25C 0.342323 no
5d_25C 7d_25C 0.382293 no
5d_25C 7d_15C 0.028871 yes
5d_25C 7d_30C 0.543485 no
5d_25C 10d_25C 0.271239 no
7d_25C 7d_15C 0.008133 yes
7d_25C 7d_30C 0.078462 no
7d_25C 10d_25C 0.025128 yes
7d_15C 7d_30C 0.076864 no
7d_15C 10d_25C 0.141563 no
7d_30C 10d_25C 0.731665 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5891.t1
MVHLKALLTLTLATSITATQTTSTCDDAYNKCVTAPDANMSTCFSDREACRHGQINSRAKLHLRHPVRVVSAEGD
CQEIFDKCRSTPGANISTCVSDKAACDDGESE*
Coding >Pro_DTO377G3_2|g5891.t1
ATGGTCCACCTAAAAGCCCTCCTCACCCTCACCCTGGCAACCAGCATCACCGCAACCCAAACCACCTCTACCTGC
GACGACGCCTACAACAAGTGCGTCACTGCCCCAGACGCCAACATGTCCACCTGCTTCTCCGACCGCGAGGCGTGT
CGACACGGCCAGATCAACTCCCGCGCAAAGCTACACTTGCGACACCCGGTGCGCGTGGTCTCCGCTGAGGGCGAT
TGTCAAGAGATCTTCGACAAGTGTCGTTCAACTCCCGGTGCCAATATCTCGACATGTGTCTCTGATAAGGCTGCT
TGCGATGATGGAGAGAGCGAATAG
Transcript >Pro_DTO377G3_2|g5891.t1
ATGGTCCACCTAAAAGCCCTCCTCACCCTCACCCTGGCAACCAGCATCACCGCAACCCAAACCACCTCTACCTGC
GACGACGCCTACAACAAGTGCGTCACTGCCCCAGACGCCAACATGTCCACCTGCTTCTCCGACCGCGAGGCGTGT
CGACACGGCCAGATCAACTCCCGCGCAAAGCTACACTTGCGACACCCGGTGCGCGTGGTCTCCGCTGAGGGCGAT
TGTCAAGAGATCTTCGACAAGTGTCGTTCAACTCCCGGTGCCAATATCTCGACATGTGTCTCTGATAAGGCTGCT
TGCGATGATGGAGAGAGCGAATAG
Gene >Pro_DTO377G3_2|g5891.t1
ATGGTCCACCTAAAAGCCCTCCTCACCCTCACCCTGGCAACCAGCATCACCGCAACCCAAACCACCTCTACCTGC
GACGACGCCTACAACAAGTGCGTCACTGCCCCAGACGCCAACATGTCCACCTGCTTCTCCGACCGCGAGGCGTGT
CGACACGGCCAGATCAACTCCCGCGCAAAGCTACACTTGCGACACCCGGTGCGCGTGGTCTCCGCTGAGGGCGAT
TGTCAAGAGATCTTCGACAAGTGTCGTTCAACTCCCGGTGCCAATATCTCGACATGTGTCTCTGATAAGGCTGCT
TGCGATGATGGAGAGAGCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail