Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5886.t1
Gene name
Locationscaffold_15:70680..74049
Strand-
Gene length (bp)3369
Transcript length (bp)3369
Coding sequence length (bp)3369
Protein length (aa) 1123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.9E-14 55 143
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.2E-13 231 298
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.7E-08 302 357
PF00023 Ank Ankyrin repeat 1.2E-03 82 110
PF00023 Ank Ankyrin repeat 3.3E-06 113 143
PF00023 Ank Ankyrin repeat 5.9E-03 188 210
PF00023 Ank Ankyrin repeat 3.7E-03 237 266
PF00023 Ank Ankyrin repeat 7.3E-04 270 299
PF00023 Ank Ankyrin repeat 9.3E-04 302 323
PF13857 Ank_5 Ankyrin repeats (many copies) 3.9E-09 99 150
PF13857 Ank_5 Ankyrin repeats (many copies) 2.8E-07 289 341
PF13637 Ank_4 Ankyrin repeats (many copies) 1.3E-09 82 133
PF13637 Ank_4 Ankyrin repeats (many copies) 2.3E-06 239 278
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-12 271 323
PF13606 Ank_3 Ankyrin repeat 3.2E-03 188 211
PF13606 Ank_3 Ankyrin repeat 4.3E-04 270 298
PF13606 Ank_3 Ankyrin repeat 3.6E-03 302 325
PF01544 CorA CorA-like Mg2+ transporter protein 1.7E-12 854 1019

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005488 binding No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 967 989 22
2 1001 1023 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5886.t1
MPASSITSDSHERLEPRLLRAAESNDIDSLKKTIALAHEYNQLNDNFLRIGLMRSAERACIAATEYLLTHGAKTD
VPSNRASPLLRAVERDHYEIVRLLLDHGACPNSADKEGRTALMTAAWKNHADILHLLIMRGADVNQRDLRRRNAL
HNLAADRACRWGWGEEVVGLLLRTECAIDGVAGQDELGRTPLHWACATGNWRMAEMLLTRNAGEGEKEGEVRGSG
LGAQIDAVELRGKTALHVATAHDRADIVQLLIAHKAAVNAASDGGWTPLHNACDKGCEAIVRILLSEGAHINAQL
LNGITPLHLAAQGGHREVVQCLLEKPDLKRRVRDNFGSTPFLRAAQFKRKDIVLLLAPFNNVDSLSDGVKEACAA
FDATVVDFGNFHNENRVKRMSVFNLLYGRDPENPRKQAVTTVPVDSRGTDFRWIHLPANNMAWVEALLTKSFIEE
GAHDVDGFKGLEKSFNYQHRGQRTHSHFMRPLCQNTPRTMLRRHEEETPEEPASENGQVRAMDSPARKQKGTGSK
PEKADSYFHDEGHGKKNKNNPKRGKSGSVPGTPKQETKGKSGQGEKQRSSLSSSTFCKDPHPLVSACNVCVFMPY
LHFETTERRQQMQDAISRAETLDFIPRGIKRTRTRDEILIYAHLSSSTTSLHVRRTLDQFFYPNIDTKSRDQDQV
VYRYQTKSPGMGADPKIFMVDQLWMWVLGTNLIVTAFPQRWDQPKNDPLNVLDGIIEDINSKTRDPVKSVYDLAM
IITNRCSGVFDRHRLGDEEYQFLDMFESSIGIATDKETVLFNQFNHASGQASEWLKSHRKLNGSFSSPPKSYNGT
DEQDQSSNYCDEDGQPLFVDRLLDIGQETNLLAETKDIRDELNMIRTVLEHQNNVLLDFQEVVCETYQGQHRSQF
EVKKRFKDQQRMIDMHLKDIDRMDKQAERIYHSITDLLDLKQKHANAFEARFARDQAAGTTRQSKTIMVFTIVTI
VFLPLSFIASIFTINLKEFESLNLGYVAKYTFGIGFAISIPLVWVALTVDDIGGFFRVGSRRWLSNRAKVSAKSE
RSEETLQALEMEKIMSLPRMRRSVDVEYGGGLLPVSTRGTGASRRPDLYGGLSNGTMRKSYDLRPSMDSRLR*
Coding >Pro_DTO377G3_2|g5886.t1
ATGCCAGCCTCAAGCATAACAAGCGACAGCCACGAGCGCCTGGAGCCACGGCTCCTCCGCGCCGCCGAATCCAAC
GACATCGACTCCCTAAAAAAGACAATAGCCCTCGCCCACGAGTACAACCAACTAAACGACAACTTCCTCCGCATC
GGCCTAATGCGCAGCGCCGAACGAGCCTGCATCGCCGCAACAGAATACCTCCTCACGCACGGCGCCAAAACCGAC
GTCCCCTCCAACCGCGCCTCACCCCTCCTCCGCGCCGTCGAGCGCGACCACTACGAAATCGTCCGTCTGCTGCTC
GACCACGGCGCCTGTCCCAACTCCGCCGACAAAGAAGGCCGCACGGCGCTCATGACCGCGGCGTGGAAGAACCAC
GCCGATATCCTGCACCTGCTTATCATGCGGGGCGCGGACGTGAACCAGCGCGATCTGCGCCGCCGGAACGCGTTG
CATAACCTCGCCGCTGATAGGGCTTGTCGGTGGGGGTGGGGGGAGGAGGTTGTGGGGTTGTTGTTGCGGACGGAG
TGTGCTATTGATGGGGTTGCGGGGCAGGATGAGCTGGGGCGGACGCCGTTGCATTGGGCTTGTGCGACGGGGAAT
TGGAGGATGGCGGAGATGTTGTTGACGAGGAATGCTGGCGAGGGGGAGAAAGAGGGGGAGGTGCGGGGGTCCGGG
CTGGGGGCGCAGATCGATGCCGTTGAGCTGCGTGGTAAGACGGCGTTGCATGTTGCTACGGCTCATGACCGTGCG
GATATCGTGCAGCTGCTGATTGCGCACAAGGCGGCGGTTAATGCTGCTAGTGATGGTGGCTGGACGCCGCTTCAT
AATGCCTGTGATAAGGGGTGTGAGGCGATTGTGCGGATTCTGCTGAGCGAAGGCGCGCATATCAACGCACAGCTT
TTGAATGGCATTACGCCGCTGCATCTTGCTGCGCAGGGCGGCCATCGCGAGGTCGTGCAGTGTCTTCTTGAGAAG
CCTGATCTGAAACGTCGGGTTAGGGATAATTTTGGCAGTACGCCGTTTCTGCGTGCGGCGCAGTTCAAGCGGAAG
GATATTGTGCTGTTGCTGGCGCCGTTTAACAATGTCGACAGTCTATCTGATGGTGTCAAGGAGGCTTGTGCGGCG
TTCGATGCTACTGTTGTTGACTTTGGAAACTTCCATAATGAGAATCGGGTTAAGCGCATGTCGGTATTTAATCTG
CTTTATGGGAGGGATCCGGAGAATCCTAGGAAACAGGCTGTTACCACTGTGCCGGTTGATAGTCGTGGGACTGAT
TTCCGGTGGATTCACTTACCGGCGAACAATATGGCGTGGGTGGAAGCTCTGCTTACCAAGTCCTTTATTGAGGAG
GGCGCACATGATGTTGATGGGTTCAAGGGGCTGGAGAAGTCTTTCAACTATCAGCATCGGGGTCAAAGGACTCAT
TCGCACTTTATGCGACCGTTGTGTCAGAATACGCCGCGGACGATGCTGCGTCGACATGAAGAGGAGACTCCGGAG
GAGCCTGCGTCTGAGAATGGGCAGGTAAGGGCCATGGATAGCCCTGCCCGCAAGCAAAAAGGCACAGGCAGCAAG
CCTGAAAAGGCGGATTCTTATTTTCACGACGAAGGGCATGGAAAAAAGAACAAGAACAATCCGAAGCGCGGCAAG
TCGGGTAGCGTACCAGGGACTCCCAAGCAGGAGACGAAGGGGAAGTCGGGCCAGGGCGAGAAACAGAGGTCATCA
CTGTCTTCATCAACCTTTTGCAAAGACCCTCACCCTCTGGTTTCTGCATGTAATGTCTGCGTGTTCATGCCGTAT
CTACATTTCGAGACCACAGAGCGCAGACAACAGATGCAGGATGCAATCTCCCGAGCGGAAACGCTTGATTTTATA
CCCAGGGGGATAAAGAGAACGCGCACAAGAGACGAAATACTCATATATGCGCATCTATCGTCCTCAACGACCTCC
CTCCATGTCCGCCGAACACTGGACCAGTTTTTCTACCCGAATATCGATACCAAGAGTCGTGATCAGGACCAAGTT
GTGTACCGGTACCAAACAAAAAGCCCCGGAATGGGGGCAGACCCCAAGATATTCATGGTGGATCAACTCTGGATG
TGGGTTCTAGGCACGAATCTGATTGTAACGGCCTTCCCGCAGAGATGGGACCAGCCCAAGAATGACCCGCTTAAT
GTGCTGGATGGGATTATCGAGGATATCAATTCCAAAACCCGCGACCCTGTCAAATCCGTCTATGATCTAGCCATG
ATAATCACCAATCGATGCTCGGGTGTCTTCGATCGACACCGCCTAGGCGACGAGGAGTACCAGTTCCTAGATATG
TTCGAGTCATCTATAGGTATAGCCACGGACAAAGAGACCGTGCTTTTTAACCAATTCAACCACGCCTCCGGGCAG
GCATCAGAGTGGCTGAAAAGTCACCGCAAGCTGAACGGCTCCTTCAGCTCTCCGCCAAAGTCCTACAATGGGACC
GACGAGCAAGATCAAAGCAGCAACTACTGCGACGAGGACGGCCAGCCACTATTCGTCGACCGACTCCTAGACATC
GGACAGGAAACCAATCTCCTAGCGGAGACAAAGGACATCAGAGACGAGCTGAACATGATCCGGACGGTGCTGGAG
CACCAGAACAACGTCCTGCTCGACTTCCAAGAAGTCGTCTGCGAGACCTATCAAGGCCAGCACCGGTCCCAATTC
GAAGTCAAGAAACGGTTCAAAGACCAGCAGCGCATGATCGACATGCACCTAAAGGATATTGACCGCATGGATAAA
CAAGCCGAGCGCATCTACCACTCCATCACGGACCTGCTCGATCTGAAACAGAAACACGCGAACGCGTTCGAGGCC
CGCTTCGCCCGTGACCAGGCTGCCGGTACAACCCGCCAGAGTAAGACAATTATGGTCTTCACTATTGTCACTATT
GTCTTCCTGCCGTTGTCGTTTATCGCCTCCATCTTCACGATCAACCTGAAAGAATTCGAGAGCTTGAATCTCGGC
TATGTGGCAAAGTATACCTTTGGTATTGGCTTTGCAATCTCCATCCCGCTTGTCTGGGTCGCTCTCACCGTTGAT
GATATCGGGGGTTTCTTCCGCGTGGGCAGTCGACGCTGGTTGTCTAACCGGGCGAAGGTGTCTGCGAAGAGTGAA
CGAAGCGAGGAAACGCTCCAGGCTTTGGAGATGGAGAAAATTATGAGTTTACCGCGCATGAGGAGGAGTGTCGAT
GTGGAATATGGTGGTGGTCTGCTACCTGTTTCTACACGCGGCACGGGGGCCTCGAGGCGGCCTGATCTATATGGT
GGATTGAGCAATGGCACTATGCGGAAAAGTTACGACCTGCGGCCTAGTATGGACTCCAGATTACGATGA
Transcript >Pro_DTO377G3_2|g5886.t1
ATGCCAGCCTCAAGCATAACAAGCGACAGCCACGAGCGCCTGGAGCCACGGCTCCTCCGCGCCGCCGAATCCAAC
GACATCGACTCCCTAAAAAAGACAATAGCCCTCGCCCACGAGTACAACCAACTAAACGACAACTTCCTCCGCATC
GGCCTAATGCGCAGCGCCGAACGAGCCTGCATCGCCGCAACAGAATACCTCCTCACGCACGGCGCCAAAACCGAC
GTCCCCTCCAACCGCGCCTCACCCCTCCTCCGCGCCGTCGAGCGCGACCACTACGAAATCGTCCGTCTGCTGCTC
GACCACGGCGCCTGTCCCAACTCCGCCGACAAAGAAGGCCGCACGGCGCTCATGACCGCGGCGTGGAAGAACCAC
GCCGATATCCTGCACCTGCTTATCATGCGGGGCGCGGACGTGAACCAGCGCGATCTGCGCCGCCGGAACGCGTTG
CATAACCTCGCCGCTGATAGGGCTTGTCGGTGGGGGTGGGGGGAGGAGGTTGTGGGGTTGTTGTTGCGGACGGAG
TGTGCTATTGATGGGGTTGCGGGGCAGGATGAGCTGGGGCGGACGCCGTTGCATTGGGCTTGTGCGACGGGGAAT
TGGAGGATGGCGGAGATGTTGTTGACGAGGAATGCTGGCGAGGGGGAGAAAGAGGGGGAGGTGCGGGGGTCCGGG
CTGGGGGCGCAGATCGATGCCGTTGAGCTGCGTGGTAAGACGGCGTTGCATGTTGCTACGGCTCATGACCGTGCG
GATATCGTGCAGCTGCTGATTGCGCACAAGGCGGCGGTTAATGCTGCTAGTGATGGTGGCTGGACGCCGCTTCAT
AATGCCTGTGATAAGGGGTGTGAGGCGATTGTGCGGATTCTGCTGAGCGAAGGCGCGCATATCAACGCACAGCTT
TTGAATGGCATTACGCCGCTGCATCTTGCTGCGCAGGGCGGCCATCGCGAGGTCGTGCAGTGTCTTCTTGAGAAG
CCTGATCTGAAACGTCGGGTTAGGGATAATTTTGGCAGTACGCCGTTTCTGCGTGCGGCGCAGTTCAAGCGGAAG
GATATTGTGCTGTTGCTGGCGCCGTTTAACAATGTCGACAGTCTATCTGATGGTGTCAAGGAGGCTTGTGCGGCG
TTCGATGCTACTGTTGTTGACTTTGGAAACTTCCATAATGAGAATCGGGTTAAGCGCATGTCGGTATTTAATCTG
CTTTATGGGAGGGATCCGGAGAATCCTAGGAAACAGGCTGTTACCACTGTGCCGGTTGATAGTCGTGGGACTGAT
TTCCGGTGGATTCACTTACCGGCGAACAATATGGCGTGGGTGGAAGCTCTGCTTACCAAGTCCTTTATTGAGGAG
GGCGCACATGATGTTGATGGGTTCAAGGGGCTGGAGAAGTCTTTCAACTATCAGCATCGGGGTCAAAGGACTCAT
TCGCACTTTATGCGACCGTTGTGTCAGAATACGCCGCGGACGATGCTGCGTCGACATGAAGAGGAGACTCCGGAG
GAGCCTGCGTCTGAGAATGGGCAGGTAAGGGCCATGGATAGCCCTGCCCGCAAGCAAAAAGGCACAGGCAGCAAG
CCTGAAAAGGCGGATTCTTATTTTCACGACGAAGGGCATGGAAAAAAGAACAAGAACAATCCGAAGCGCGGCAAG
TCGGGTAGCGTACCAGGGACTCCCAAGCAGGAGACGAAGGGGAAGTCGGGCCAGGGCGAGAAACAGAGGTCATCA
CTGTCTTCATCAACCTTTTGCAAAGACCCTCACCCTCTGGTTTCTGCATGTAATGTCTGCGTGTTCATGCCGTAT
CTACATTTCGAGACCACAGAGCGCAGACAACAGATGCAGGATGCAATCTCCCGAGCGGAAACGCTTGATTTTATA
CCCAGGGGGATAAAGAGAACGCGCACAAGAGACGAAATACTCATATATGCGCATCTATCGTCCTCAACGACCTCC
CTCCATGTCCGCCGAACACTGGACCAGTTTTTCTACCCGAATATCGATACCAAGAGTCGTGATCAGGACCAAGTT
GTGTACCGGTACCAAACAAAAAGCCCCGGAATGGGGGCAGACCCCAAGATATTCATGGTGGATCAACTCTGGATG
TGGGTTCTAGGCACGAATCTGATTGTAACGGCCTTCCCGCAGAGATGGGACCAGCCCAAGAATGACCCGCTTAAT
GTGCTGGATGGGATTATCGAGGATATCAATTCCAAAACCCGCGACCCTGTCAAATCCGTCTATGATCTAGCCATG
ATAATCACCAATCGATGCTCGGGTGTCTTCGATCGACACCGCCTAGGCGACGAGGAGTACCAGTTCCTAGATATG
TTCGAGTCATCTATAGGTATAGCCACGGACAAAGAGACCGTGCTTTTTAACCAATTCAACCACGCCTCCGGGCAG
GCATCAGAGTGGCTGAAAAGTCACCGCAAGCTGAACGGCTCCTTCAGCTCTCCGCCAAAGTCCTACAATGGGACC
GACGAGCAAGATCAAAGCAGCAACTACTGCGACGAGGACGGCCAGCCACTATTCGTCGACCGACTCCTAGACATC
GGACAGGAAACCAATCTCCTAGCGGAGACAAAGGACATCAGAGACGAGCTGAACATGATCCGGACGGTGCTGGAG
CACCAGAACAACGTCCTGCTCGACTTCCAAGAAGTCGTCTGCGAGACCTATCAAGGCCAGCACCGGTCCCAATTC
GAAGTCAAGAAACGGTTCAAAGACCAGCAGCGCATGATCGACATGCACCTAAAGGATATTGACCGCATGGATAAA
CAAGCCGAGCGCATCTACCACTCCATCACGGACCTGCTCGATCTGAAACAGAAACACGCGAACGCGTTCGAGGCC
CGCTTCGCCCGTGACCAGGCTGCCGGTACAACCCGCCAGAGTAAGACAATTATGGTCTTCACTATTGTCACTATT
GTCTTCCTGCCGTTGTCGTTTATCGCCTCCATCTTCACGATCAACCTGAAAGAATTCGAGAGCTTGAATCTCGGC
TATGTGGCAAAGTATACCTTTGGTATTGGCTTTGCAATCTCCATCCCGCTTGTCTGGGTCGCTCTCACCGTTGAT
GATATCGGGGGTTTCTTCCGCGTGGGCAGTCGACGCTGGTTGTCTAACCGGGCGAAGGTGTCTGCGAAGAGTGAA
CGAAGCGAGGAAACGCTCCAGGCTTTGGAGATGGAGAAAATTATGAGTTTACCGCGCATGAGGAGGAGTGTCGAT
GTGGAATATGGTGGTGGTCTGCTACCTGTTTCTACACGCGGCACGGGGGCCTCGAGGCGGCCTGATCTATATGGT
GGATTGAGCAATGGCACTATGCGGAAAAGTTACGACCTGCGGCCTAGTATGGACTCCAGATTACGATGA
Gene >Pro_DTO377G3_2|g5886.t1
ATGCCAGCCTCAAGCATAACAAGCGACAGCCACGAGCGCCTGGAGCCACGGCTCCTCCGCGCCGCCGAATCCAAC
GACATCGACTCCCTAAAAAAGACAATAGCCCTCGCCCACGAGTACAACCAACTAAACGACAACTTCCTCCGCATC
GGCCTAATGCGCAGCGCCGAACGAGCCTGCATCGCCGCAACAGAATACCTCCTCACGCACGGCGCCAAAACCGAC
GTCCCCTCCAACCGCGCCTCACCCCTCCTCCGCGCCGTCGAGCGCGACCACTACGAAATCGTCCGTCTGCTGCTC
GACCACGGCGCCTGTCCCAACTCCGCCGACAAAGAAGGCCGCACGGCGCTCATGACCGCGGCGTGGAAGAACCAC
GCCGATATCCTGCACCTGCTTATCATGCGGGGCGCGGACGTGAACCAGCGCGATCTGCGCCGCCGGAACGCGTTG
CATAACCTCGCCGCTGATAGGGCTTGTCGGTGGGGGTGGGGGGAGGAGGTTGTGGGGTTGTTGTTGCGGACGGAG
TGTGCTATTGATGGGGTTGCGGGGCAGGATGAGCTGGGGCGGACGCCGTTGCATTGGGCTTGTGCGACGGGGAAT
TGGAGGATGGCGGAGATGTTGTTGACGAGGAATGCTGGCGAGGGGGAGAAAGAGGGGGAGGTGCGGGGGTCCGGG
CTGGGGGCGCAGATCGATGCCGTTGAGCTGCGTGGTAAGACGGCGTTGCATGTTGCTACGGCTCATGACCGTGCG
GATATCGTGCAGCTGCTGATTGCGCACAAGGCGGCGGTTAATGCTGCTAGTGATGGTGGCTGGACGCCGCTTCAT
AATGCCTGTGATAAGGGGTGTGAGGCGATTGTGCGGATTCTGCTGAGCGAAGGCGCGCATATCAACGCACAGCTT
TTGAATGGCATTACGCCGCTGCATCTTGCTGCGCAGGGCGGCCATCGCGAGGTCGTGCAGTGTCTTCTTGAGAAG
CCTGATCTGAAACGTCGGGTTAGGGATAATTTTGGCAGTACGCCGTTTCTGCGTGCGGCGCAGTTCAAGCGGAAG
GATATTGTGCTGTTGCTGGCGCCGTTTAACAATGTCGACAGTCTATCTGATGGTGTCAAGGAGGCTTGTGCGGCG
TTCGATGCTACTGTTGTTGACTTTGGAAACTTCCATAATGAGAATCGGGTTAAGCGCATGTCGGTATTTAATCTG
CTTTATGGGAGGGATCCGGAGAATCCTAGGAAACAGGCTGTTACCACTGTGCCGGTTGATAGTCGTGGGACTGAT
TTCCGGTGGATTCACTTACCGGCGAACAATATGGCGTGGGTGGAAGCTCTGCTTACCAAGTCCTTTATTGAGGAG
GGCGCACATGATGTTGATGGGTTCAAGGGGCTGGAGAAGTCTTTCAACTATCAGCATCGGGGTCAAAGGACTCAT
TCGCACTTTATGCGACCGTTGTGTCAGAATACGCCGCGGACGATGCTGCGTCGACATGAAGAGGAGACTCCGGAG
GAGCCTGCGTCTGAGAATGGGCAGGTAAGGGCCATGGATAGCCCTGCCCGCAAGCAAAAAGGCACAGGCAGCAAG
CCTGAAAAGGCGGATTCTTATTTTCACGACGAAGGGCATGGAAAAAAGAACAAGAACAATCCGAAGCGCGGCAAG
TCGGGTAGCGTACCAGGGACTCCCAAGCAGGAGACGAAGGGGAAGTCGGGCCAGGGCGAGAAACAGAGGTCATCA
CTGTCTTCATCAACCTTTTGCAAAGACCCTCACCCTCTGGTTTCTGCATGTAATGTCTGCGTGTTCATGCCGTAT
CTACATTTCGAGACCACAGAGCGCAGACAACAGATGCAGGATGCAATCTCCCGAGCGGAAACGCTTGATTTTATA
CCCAGGGGGATAAAGAGAACGCGCACAAGAGACGAAATACTCATATATGCGCATCTATCGTCCTCAACGACCTCC
CTCCATGTCCGCCGAACACTGGACCAGTTTTTCTACCCGAATATCGATACCAAGAGTCGTGATCAGGACCAAGTT
GTGTACCGGTACCAAACAAAAAGCCCCGGAATGGGGGCAGACCCCAAGATATTCATGGTGGATCAACTCTGGATG
TGGGTTCTAGGCACGAATCTGATTGTAACGGCCTTCCCGCAGAGATGGGACCAGCCCAAGAATGACCCGCTTAAT
GTGCTGGATGGGATTATCGAGGATATCAATTCCAAAACCCGCGACCCTGTCAAATCCGTCTATGATCTAGCCATG
ATAATCACCAATCGATGCTCGGGTGTCTTCGATCGACACCGCCTAGGCGACGAGGAGTACCAGTTCCTAGATATG
TTCGAGTCATCTATAGGTATAGCCACGGACAAAGAGACCGTGCTTTTTAACCAATTCAACCACGCCTCCGGGCAG
GCATCAGAGTGGCTGAAAAGTCACCGCAAGCTGAACGGCTCCTTCAGCTCTCCGCCAAAGTCCTACAATGGGACC
GACGAGCAAGATCAAAGCAGCAACTACTGCGACGAGGACGGCCAGCCACTATTCGTCGACCGACTCCTAGACATC
GGACAGGAAACCAATCTCCTAGCGGAGACAAAGGACATCAGAGACGAGCTGAACATGATCCGGACGGTGCTGGAG
CACCAGAACAACGTCCTGCTCGACTTCCAAGAAGTCGTCTGCGAGACCTATCAAGGCCAGCACCGGTCCCAATTC
GAAGTCAAGAAACGGTTCAAAGACCAGCAGCGCATGATCGACATGCACCTAAAGGATATTGACCGCATGGATAAA
CAAGCCGAGCGCATCTACCACTCCATCACGGACCTGCTCGATCTGAAACAGAAACACGCGAACGCGTTCGAGGCC
CGCTTCGCCCGTGACCAGGCTGCCGGTACAACCCGCCAGAGTAAGACAATTATGGTCTTCACTATTGTCACTATT
GTCTTCCTGCCGTTGTCGTTTATCGCCTCCATCTTCACGATCAACCTGAAAGAATTCGAGAGCTTGAATCTCGGC
TATGTGGCAAAGTATACCTTTGGTATTGGCTTTGCAATCTCCATCCCGCTTGTCTGGGTCGCTCTCACCGTTGAT
GATATCGGGGGTTTCTTCCGCGTGGGCAGTCGACGCTGGTTGTCTAACCGGGCGAAGGTGTCTGCGAAGAGTGAA
CGAAGCGAGGAAACGCTCCAGGCTTTGGAGATGGAGAAAATTATGAGTTTACCGCGCATGAGGAGGAGTGTCGAT
GTGGAATATGGTGGTGGTCTGCTACCTGTTTCTACACGCGGCACGGGGGCCTCGAGGCGGCCTGATCTATATGGT
GGATTGAGCAATGGCACTATGCGGAAAAGTTACGACCTGCGGCCTAGTATGGACTCCAGATTACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail