Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5878.t1
Gene name
Locationscaffold_15:50843..51802
Strand+
Gene length (bp)959
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 6.6E-43 29 274
PF00106 adh_short short chain dehydrogenase 5.2E-40 21 225
PF08659 KR KR domain 9.8E-10 24 137

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5878.t1
MSAEEQVKLSDFSSIFSLEGKVAVVTGGSRGLGLHAASGLLQAGCSKVYITSRKKAACDEAVAALNAIPNKRPGA
QAISVPADSADMKELDRLVAEVGKTTDHVDILFANAGATWGEKFDTHPEKMFSKVMDLNVKSVFYTIQKFTPLLT
AKATVADPSRVIITASVAGIGIGAIGEHATPSYSASKAAAIHLAKNLAVELGPRHVLTNAIAPGFFPSKMATGLI
EAKGGIKHLEEFSPNGRLGKPEDIAGLVVFLGSRASSHLNGAVIATDGGAVIKGRL*
Coding >Pro_DTO377G3_2|g5878.t1
ATGTCCGCCGAAGAACAAGTCAAGCTCTCCGACTTCTCCAGCATCTTCTCCCTCGAGGGCAAGGTCGCTGTCGTA
ACAGGCGGTTCCCGGGGACTAGGACTACATGCAGCCTCAGGCCTCCTCCAAGCCGGCTGCTCCAAAGTCTACATC
ACTTCCCGCAAGAAGGCAGCCTGCGACGAAGCAGTCGCTGCTCTCAATGCCATTCCCAACAAGCGGCCTGGCGCA
CAAGCCATCTCCGTGCCGGCCGACAGCGCAGATATGAAAGAGCTAGACCGACTTGTCGCCGAGGTAGGCAAGACC
ACAGACCATGTTGACATTCTCTTCGCCAATGCCGGCGCAACATGGGGCGAGAAGTTCGACACTCACCCCGAGAAG
ATGTTCTCGAAGGTTATGGATTTGAATGTTAAGAGCGTGTTCTACACGATCCAAAAGTTCACCCCGCTCCTCACA
GCAAAGGCAACCGTCGCAGATCCATCCCGTGTCATTATCACCGCCTCTGTGGCGGGTATTGGCATTGGCGCGATC
GGTGAGCACGCAACGCCGTCTTACTCTGCTTCCAAGGCGGCTGCTATCCATCTCGCGAAGAATCTGGCTGTCGAG
CTTGGGCCGCGTCATGTCTTGACTAATGCTATTGCACCGGGATTCTTCCCCTCGAAGATGGCTACTGGGCTTATT
GAGGCCAAGGGTGGGATAAAGCATCTGGAGGAGTTCTCGCCGAACGGTCGTCTCGGAAAGCCCGAGGATATTGCT
GGTTTGGTGGTCTTCCTCGGGTCTAGGGCTTCGAGTCATTTGAATGGAGCGGTCATTGCGACAGACGGTGGAGCT
GTGATCAAGGGGAGACTGTAA
Transcript >Pro_DTO377G3_2|g5878.t1
ATGTCCGCCGAAGAACAAGTCAAGCTCTCCGACTTCTCCAGCATCTTCTCCCTCGAGGGCAAGGTCGCTGTCGTA
ACAGGCGGTTCCCGGGGACTAGGACTACATGCAGCCTCAGGCCTCCTCCAAGCCGGCTGCTCCAAAGTCTACATC
ACTTCCCGCAAGAAGGCAGCCTGCGACGAAGCAGTCGCTGCTCTCAATGCCATTCCCAACAAGCGGCCTGGCGCA
CAAGCCATCTCCGTGCCGGCCGACAGCGCAGATATGAAAGAGCTAGACCGACTTGTCGCCGAGGTAGGCAAGACC
ACAGACCATGTTGACATTCTCTTCGCCAATGCCGGCGCAACATGGGGCGAGAAGTTCGACACTCACCCCGAGAAG
ATGTTCTCGAAGGTTATGGATTTGAATGTTAAGAGCGTGTTCTACACGATCCAAAAGTTCACCCCGCTCCTCACA
GCAAAGGCAACCGTCGCAGATCCATCCCGTGTCATTATCACCGCCTCTGTGGCGGGTATTGGCATTGGCGCGATC
GGTGAGCACGCAACGCCGTCTTACTCTGCTTCCAAGGCGGCTGCTATCCATCTCGCGAAGAATCTGGCTGTCGAG
CTTGGGCCGCGTCATGTCTTGACTAATGCTATTGCACCGGGATTCTTCCCCTCGAAGATGGCTACTGGGCTTATT
GAGGCCAAGGGTGGGATAAAGCATCTGGAGGAGTTCTCGCCGAACGGTCGTCTCGGAAAGCCCGAGGATATTGCT
GGTTTGGTGGTCTTCCTCGGGTCTAGGGCTTCGAGTCATTTGAATGGAGCGGTCATTGCGACAGACGGTGGAGCT
GTGATCAAGGGGAGACTGTAA
Gene >Pro_DTO377G3_2|g5878.t1
ATGTCCGCCGAAGAACAAGTCAAGCTCTCCGACTTCTCCAGCATCTTCTCCCTCGAGGGCAAGGTCGCTGTCGTA
ACAGGCGGTTCCCGGGGACTAGGACTACATGCAGCCTCAGGGTATGTATCTCTCTAGTACCCTGCCAATTATTCC
TGACATATCCTAACATATCTGAAGCCTCCTCCAAGCCGGCTGCTCCAAAGTCTACATCACTTCCCGCAAGAAGGC
AGCCTGCGACGAAGCAGTCGCTGCTCTCAATGCCATTCCCAACAAGCGGCCTGGCGCACAAGCCATCTCCGTGCC
GGCCGACAGCGCAGATATGAAAGAGCTAGACCGACTTGTCGCCGAGGTAGGCAAGACCACAGACCATGTTGACAT
TCTCTTCGCCAATGCCGGCGCAACATGGGGCGAGAAGTTCGACACTCACCCCGAGAAGATGTTCTCGAAGGTTAT
GGATTTGAATGTTAAGAGCGTGTTCTACACGATCCAAAAGTATGTTATTTGCTAGCCGGAACTAGGGATGAGAAG
GATTCTAACATCGGATTAGGTTCACCCCGCTCCTCACAGCAAAGGCAACCGTCGCAGATCCATCCCGTGTCATTA
TCACCGCCTCTGTGGCGGGTATTGGCATTGGCGCGATCGGTGAGCACGCAACGCCGTCTTACTCTGCTTCCAAGG
CGGCTGCTATCCATCTCGCGAAGAATCTGGCTGTCGAGCTTGGGCCGCGTCATGTCTTGACTAATGCTATTGCAC
CGGGATTCTTCCCCTCGAAGATGGCTACTGGGCTTATTGAGGCCAAGGGTGGGATAAAGCATCTGGAGGAGTTCT
CGCCGAACGGTCGTCTCGGAAAGCCCGAGGATATTGCTGGTTTGGTGGTCTTCCTCGGGTCTAGGGCTTCGAGTC
ATTTGAATGGAGCGGTCATTGCGACAGACGGTGGAGCTGTGATCAAGGGGAGACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail