Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5871.t1
Gene name
Locationscaffold_15:37877..39854
Strand+
Gene length (bp)1977
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 2.8E-08 84 165

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 137 159 22
2 205 227 22
3 264 286 22
4 296 317 21
5 330 349 19
6 432 454 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5871.t1
MADTKTPVSDSHDAPSIADNAIGHGAVIDMQHYKDTVPLWKRVWQHSLTQMMLLSIQAFCGPAMADAITGLGGGG
LASTRVSNISTSIGYATLAVVCCIGGPLVNKIGIKWALILGSMSFPIQGSAYYCNSKFGNEWYLILSGAISGIGT
ACWYVAEAGAIMTLAPSGARGKYLALWIVSRNLGQLVGGAINLSKNFEKGVSGGVTSDTFIAFVIIECLALPFAL
LITPFERVVRSDGTKIVTSETLSTKMEFKYIAKTLSSKLIILSAPWALWSFFYGGTWSTYLGTYFTVRARALSSL
ISPFFCIIGCFGLGFILDMKGFSQRRRAQIGLYTVIILNVGVYIWSIIMQVKFNHNKPGAIDWDDGLYASSFLPY
FFVQTTGPLSQSYMYWLLSSFATDSQENVRNGAAFRCIEAVGQAIAYGMNTQIKTNPLIGFCVTFALLGASVIPM
ILLVNTTPDRIPADLVAEEQNAALEKIRDV*
Coding >Pro_DTO377G3_2|g5871.t1
ATGGCCGACACAAAGACTCCTGTCTCGGATTCGCACGATGCTCCTTCTATCGCAGATAATGCCATCGGCCATGGT
GCTGTGATTGACATGCAGCACTACAAGGACACCGTTCCGCTGTGGAAGCGAGTATGGCAGCATAGTCTGACACAG
ATGATGCTGTTGAGCATCCAAGCATTCTGTGGACCAGCAATGGCTGATGCAATTACCGGCCTCGGTGGCGGTGGT
CTTGCCTCTACTCGGGTGTCAAATATCTCGACCTCAATTGGATATGCCACGCTGGCAGTCGTCTGCTGCATCGGA
GGTCCTCTTGTGAACAAAATCGGCATCAAGTGGGCTCTTATTCTCGGCTCAATGTCCTTCCCAATCCAAGGCTCG
GCATACTACTGCAACAGCAAATTTGGAAACGAATGGTACCTCATCCTGAGCGGTGCTATCAGCGGTATCGGGACT
GCTTGCTGGTATGTCGCTGAAGCTGGAGCCATCATGACGCTTGCCCCCTCCGGCGCCCGTGGGAAGTATCTGGCT
CTGTGGATCGTTTCGCGAAATCTTGGACAATTGGTCGGCGGTGCAATCAACCTATCTAAGAACTTCGAAAAAGGC
GTCAGTGGCGGAGTCACTTCCGATACGTTTATTGCCTTTGTGATCATTGAGTGTCTTGCGCTACCATTCGCGCTA
TTGATCACACCCTTCGAACGCGTTGTCCGGTCTGACGGTACAAAGATTGTCACTTCGGAAACTCTTTCCACCAAG
ATGGAATTCAAGTATATTGCAAAGACCCTGAGCTCGAAACTTATTATTCTTTCTGCGCCCTGGGCACTTTGGTCA
TTTTTCTACGGTGGTACTTGGTCTACATATCTAGGAACTTATTTCACCGTCCGTGCTCGCGCTCTCTCGTCGCTC
ATCTCGCCTTTCTTTTGCATCATTGGCTGTTTCGGCCTCGGATTCATTCTCGACATGAAGGGTTTCAGCCAGCGC
CGTCGTGCCCAGATCGGCCTCTACACTGTCATCATCCTCAATGTCGGCGTCTATATCTGGTCCATTATTATGCAG
GTCAAGTTCAACCACAACAAGCCCGGCGCCATCGATTGGGACGATGGACTGTACGCTTCGTCGTTCCTACCATAT
TTCTTCGTGCAGACGACCGGTCCGCTGTCCCAGTCGTATATGTATTGGCTTTTGTCTTCCTTCGCCACCGACTCG
CAGGAAAATGTCCGCAATGGTGCCGCATTCAGATGCATTGAAGCTGTTGGCCAAGCTATTGCCTATGGCATGAAC
ACCCAGATTAAAACTAATCCTCTGATTGGATTCTGCGTGACGTTCGCCCTACTCGGAGCCTCTGTAATCCCCATG
ATTCTGCTTGTCAACACGACACCGGACCGTATCCCTGCAGATTTAGTTGCCGAGGAGCAGAATGCTGCTCTTGAG
AAGATTCGAGATGTCTAA
Transcript >Pro_DTO377G3_2|g5871.t1
ATGGCCGACACAAAGACTCCTGTCTCGGATTCGCACGATGCTCCTTCTATCGCAGATAATGCCATCGGCCATGGT
GCTGTGATTGACATGCAGCACTACAAGGACACCGTTCCGCTGTGGAAGCGAGTATGGCAGCATAGTCTGACACAG
ATGATGCTGTTGAGCATCCAAGCATTCTGTGGACCAGCAATGGCTGATGCAATTACCGGCCTCGGTGGCGGTGGT
CTTGCCTCTACTCGGGTGTCAAATATCTCGACCTCAATTGGATATGCCACGCTGGCAGTCGTCTGCTGCATCGGA
GGTCCTCTTGTGAACAAAATCGGCATCAAGTGGGCTCTTATTCTCGGCTCAATGTCCTTCCCAATCCAAGGCTCG
GCATACTACTGCAACAGCAAATTTGGAAACGAATGGTACCTCATCCTGAGCGGTGCTATCAGCGGTATCGGGACT
GCTTGCTGGTATGTCGCTGAAGCTGGAGCCATCATGACGCTTGCCCCCTCCGGCGCCCGTGGGAAGTATCTGGCT
CTGTGGATCGTTTCGCGAAATCTTGGACAATTGGTCGGCGGTGCAATCAACCTATCTAAGAACTTCGAAAAAGGC
GTCAGTGGCGGAGTCACTTCCGATACGTTTATTGCCTTTGTGATCATTGAGTGTCTTGCGCTACCATTCGCGCTA
TTGATCACACCCTTCGAACGCGTTGTCCGGTCTGACGGTACAAAGATTGTCACTTCGGAAACTCTTTCCACCAAG
ATGGAATTCAAGTATATTGCAAAGACCCTGAGCTCGAAACTTATTATTCTTTCTGCGCCCTGGGCACTTTGGTCA
TTTTTCTACGGTGGTACTTGGTCTACATATCTAGGAACTTATTTCACCGTCCGTGCTCGCGCTCTCTCGTCGCTC
ATCTCGCCTTTCTTTTGCATCATTGGCTGTTTCGGCCTCGGATTCATTCTCGACATGAAGGGTTTCAGCCAGCGC
CGTCGTGCCCAGATCGGCCTCTACACTGTCATCATCCTCAATGTCGGCGTCTATATCTGGTCCATTATTATGCAG
GTCAAGTTCAACCACAACAAGCCCGGCGCCATCGATTGGGACGATGGACTGTACGCTTCGTCGTTCCTACCATAT
TTCTTCGTGCAGACGACCGGTCCGCTGTCCCAGTCGTATATGTATTGGCTTTTGTCTTCCTTCGCCACCGACTCG
CAGGAAAATGTCCGCAATGGTGCCGCATTCAGATGCATTGAAGCTGTTGGCCAAGCTATTGCCTATGGCATGAAC
ACCCAGATTAAAACTAATCCTCTGATTGGATTCTGCGTGACGTTCGCCCTACTCGGAGCCTCTGTAATCCCCATG
ATTCTGCTTGTCAACACGACACCGGACCGTATCCCTGCAGATTTAGTTGCCGAGGAGCAGAATGCTGCTCTTGAG
AAGATTCGAGATGTCTAA
Gene >Pro_DTO377G3_2|g5871.t1
ATGGCCGACACAAAGACTCCTGTCTCGGATTCGCACGATGCTCCTTCTATCGCAGATAATGCCATCGGCCATGGT
GCTGTGATTGACATGCAGCACTACAAGGACACCGTTCCGCTGTGGAAGCGAGTATGGCAGCATAGTCTGACACAG
ATGATGCTGTTGAGCATCCAAGCATTCTGTGGACCAGCAATGGCTGATGCAATTACCGGTAAGACTGATTCACCA
TTATACGCTAGGCTACAGAATGGCCTGGACCTTTCGCTAATGTTTTGCAGGCCTCGGTGGCGGTGGTCTTGCCTC
TACTCGGGTGTCAAATATCTCGACCTCAATTGGATATGCCACGCTGGCAGTCGGTATGTTTCATTACCCAACATG
AGTATTTAGATACTAATTTGAATAGTCTGCTGCATCGGAGGTCCTCTTGTGAACAAAATCGGCATCAAGTGGGCT
CTTATTCTCGGCTCAATGTCCTTCCCAATCCAAGGCTCGGCATACTACTGCAACAGCAAATTTGGAAACGAATGG
GTGAGCGATGGCAATGACAATGGAAACGACAAGAAATGTGACTGCATGATCTAACAAGTCCCTCCTAGTACCTCA
TCCTGAGCGGTGCTATCAGCGGTATCGGGACTGCTTGCTGGTATGTCGCTGAAGCTGGAGCCATCATGACGCTTG
CCCCCTCCGGCGCCCGTGGGAAGTATCTGGCTCTGTGGATCGTTTCGCGAAATCTTGGACAATTGGTCGGCGGTG
CAATCAAGTGAGTAATGCCTCAGTCAAAGACTCGAATGGGAAATTTGGACTAATACTTTCGCTCTATGTAGCCTA
TCTAAGAACTTCGAAAAAGGCGTCAGTGGCGGAGTCACTTCCGATACGTTTATTGCCTTTGTGATCATTGAGTGT
CTTGCGTGGGTTCTTATAAGAGAGAATTGCCTGCAACCTTATGCTTATGATGTTTAATAGGCTACCATTCGCGCT
ATTGATCACACCCTTCGAACGCGTTGTCCGGTCTGACGGTACAAAGATTGTCACTTCGGAAACTCTTTCCACCAA
GATGGAATTCAAGTATATTGCAAAGACCCTGAGCTCGAAACTTATTATTCTTTCTGCGCCCTGGGCACTTTGGTC
ATTTTTCTACGGGTAAGCCCGACAGTCACTGCCATCACCATCAAAAGCGATAATGCTAATATTCGAAAGTGGTAC
TTGGTCTACATATCTAGGAACTTATTTCACCGTCCGTGCTCGCGCTCTCTCGTCGCTCATCTCGCCTTTCTTTTG
CATGTAAGTCATGCGAAATCATATCATCAACACAAACTAACCTTGGTGCGTATCAGCATTGGCTGTTTCGGCCTC
GGATTCATTCTCGACATGAAGGGTTTCAGCCAGCGCCGTCGTGCCCAGATCGGCCTCTACACTGTCATCATCCTC
AATGTCGGCGTCTATATCTGGTCCATTATTATGCAGGTCAAGTTCAACCACAACAAGCCCGGCGCCATCGATTGG
GACGATGGACTGTACGCTTCGTCGTTCCTACCATATTTCTTCGTGCAGACGACCGGTCCGCTGTCCCAGTCGTAT
ATGTATTGGCTTTTGTCTTCCTTCGCCACCGACTCGCAGGGTAAGTGACTCCATAGACTCGGACCCGAGTCCATC
ACGGCATTGGACGCTAATGGCAATTTCAGAAAATGTCCGCAATGGTGCCGCATTCAGATGCATTGAAGCTGTTGG
CCAAGCTATTGCCTATGGCATGAACACCCAGATTAAAACTAATCCTCTGATTGGATTGTAAGTTCAATCATCTGA
ATTCGTCCCTTTTGACAAAAAGCCAACTGACCTGATTCAAGCTGCGTGACGTTCGCCCTACTCGGAGCCTCTGTA
ATCCCCATGATTCTGCTTGTCAACACGACACCGGACCGTATCCCTGCAGATTTAGTTGCCGAGGAGCAGAATGCT
GCTCTTGAGAAGATTCGAGATGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail