Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5867.t1
Gene name
Locationscaffold_15:29707..31407
Strand+
Gene length (bp)1700
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 5.6E-140 46 507

GO

GO Term Description Terminal node
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0005509 calcium ion binding Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0015923 mannosidase activity No
GO:0004559 alpha-mannosidase activity No
GO:0043167 ion binding No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5867.t1
MRISSLSLPLMLGLAGSSAAYPHPEPEVILPRQSDSQTKADAVKEAFQHAWNGYVKYAFPHDELHPVSNGYGDSR
NGWGASAVDALSTAIVMGNQDAVQKILDHIETIDFSKTSDQVSLFETTIRYLAGMLSGYDLLKGPASNLAPKSAQ
VDALLTQSKKLADVLKFAFDTPSGVPYNNLNISSKGNDGSTTNGLAVTGTLVLEWTRLSDLTGDDEYAKISQKAQ
SYLLNPQPSSGEPFPGLVGSNINISNGHFTDGAVTWNGGDDSFYEYLIKMFVYDPKRFESYKDRWVLAAESTIKN
LQSHPAPRPEVTWLASYNNGQYDLSSQHLTCFDGGSFILGGTVLDRQDFIDFGLQLVNGCEATYNQTLTGIGPDS
WGWDPTKVPSDQKDFYEKAGFYINSGSYDLRPEVIESFYYAYRVTGKEIYRDWVWNSFKAINATCRTDSGFAAVS
NVNTAGGGSKYDNEESFLFAEVLKYAYLVHAEDAPWQVQKGQKNSFVYNTEAHPMRVSHT*
Coding >Pro_DTO377G3_2|g5867.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
AATGGATGGGGAGCCTCCGCTGTCGATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAG
ATCCTGGACCACATCGAGACTATTGACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGA
TATCTTGCTGGCATGTTGTCCGGCTATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAA
GTCGATGCCCTGCTTACCCAGTCCAAGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTT
CCCTACAATAACCTTAACATCAGTTCCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACT
CTGGTGCTGGAGTGGACCCGGTTGTCTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAG
TCGTACCTTTTGAACCCTCAGCCATCAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCC
AACGGCCATTTCACCGACGGTGCTGTCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATG
TTCGTGTACGACCCCAAGCGGTTCGAGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAAC
CTCCAGTCGCACCCCGCCCCTCGCCCGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGC
TCGCAGCACCTGACCTGCTTCGATGGCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATC
GATTTCGGCTTGCAGCTCGTAAATGGCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCG
TGGGGCTGGGACCCGACGAAAGTGCCATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGC
GGCTCGTATGACTTGCGCCCTGAAGTGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCTAC
CGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACTGACTCGGGCTTTGCTGCTGTGAGC
AACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTCCTCTTTGCTGAAGTCCTGAAATAT
GCATACCTTGTACATGCCGAGGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATTCCTTTGTGTACAATACC
GAGGCTCATCCCATGAGAGTGTCCCACACCTAG
Transcript >Pro_DTO377G3_2|g5867.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
AATGGATGGGGAGCCTCCGCTGTCGATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAG
ATCCTGGACCACATCGAGACTATTGACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGA
TATCTTGCTGGCATGTTGTCCGGCTATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAA
GTCGATGCCCTGCTTACCCAGTCCAAGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTT
CCCTACAATAACCTTAACATCAGTTCCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACT
CTGGTGCTGGAGTGGACCCGGTTGTCTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAG
TCGTACCTTTTGAACCCTCAGCCATCAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCC
AACGGCCATTTCACCGACGGTGCTGTCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATG
TTCGTGTACGACCCCAAGCGGTTCGAGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAAC
CTCCAGTCGCACCCCGCCCCTCGCCCGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGC
TCGCAGCACCTGACCTGCTTCGATGGCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATC
GATTTCGGCTTGCAGCTCGTAAATGGCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCG
TGGGGCTGGGACCCGACGAAAGTGCCATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGC
GGCTCGTATGACTTGCGCCCTGAAGTGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCTAC
CGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACTGACTCGGGCTTTGCTGCTGTGAGC
AACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTCCTCTTTGCTGAAGTCCTGAAATAT
GCATACCTTGTACATGCCGAGGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATTCCTTTGTGTACAATACC
GAGGCTCATCCCATGAGAGTGTCCCACACCTAG
Gene >Pro_DTO377G3_2|g5867.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
TGAACATGTCCGATTATCCAGTTCTTGCTGTGAAACTGACACGCGATAGGAATGGATGGGGAGCCTCCGCTGTCG
ATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAGATCCTGGACCACATCGAGACTATTG
ACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGATATCTTGCTGGCATGTTGTCCGGCT
ATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAAGTCGATGCCCTGCTTACCCAGTCCA
AGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTTCCCTACAATAACCTTAACATCAGTT
CCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACTCTGGTGCTGGAGTGGACCCGGTTGT
CTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAGTCGTACCTTTTGAACCCTCAGCCAT
CAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCCAACGGCCATTTCACCGACGGTGCTG
TCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATGTTCGTGTACGACCCCAAGCGGTTCG
AGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAACCTCCAGTCGCACCCCGCCCCTCGCC
CGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGCTCGCAGCACCTGACCTGCTTCGATG
GCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATCGATTTCGGCTTGCAGCTCGTAAATG
GCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCGTGGGGCTGGGACCCGACGAAAGTGC
CATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGCGGCTCGTATGACTTGCGCCCTGAAG
TGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCGTGGGTCATTCTCCCTTCCACTGATGTT
CTAATATACTGACTCATATAGTACCGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACT
GACTCGGGCTTTGCTGCTGTGAGCAACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTC
CTCTTTGCTGAAGTCCTGAAATATGCATACCTTGTACATGCCGAGGGTAAGTTGCTAGTCTTCCCAGTCACCCTT
CTTTTTTTCAAACATTGCTAATCCTGGGTTCTGGTATAGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATT
CCTTTGTGTACAATACCGAGGCTCATCCCATGAGAGTGTCCCACACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail