Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5860.t1
Gene name
Locationscaffold_15:8217..9602
Strand-
Gene length (bp)1385
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04446 Thg1 tRNAHis guanylyltransferase 9.8E-54 6 137
PF14413 Thg1C Thg1 C terminal domain 9.8E-53 141 267

GO

GO Term Description Terminal node
GO:0008193 tRNA guanylyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0000287 magnesium ion binding Yes
GO:0043167 ion binding No
GO:0070568 guanylyltransferase activity No
GO:0006399 tRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006396 RNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0046872 metal ion binding No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0008192 RNA guanylyltransferase activity No
GO:0044238 primary metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0043169 cation binding No
GO:0034470 ncRNA processing No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009451 RNA modification No
GO:0008033 tRNA processing No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5860.t1
MANSRFEYVKSFEQPDVLLPSTWIVVRIDGRGFHKLSDHYAFAKPNDRRALDLMNAAAVEVMKELPDLCIAYGVS
DEFSFVFHPNCQLFERRNGKLVTTIVSTFTAHYIYKWSEFFPERPLLPPYLPSFDGRAVIYPNNQILRDYMSWRQ
VDCHINNLYNTTFWTMVLQGGMSNTDAEQELKGTVSADKNEILFKRFGINYNNELEIYKKGTVLYRQYELEEPKP
TKSPAGEESLVVESKQSRSQQDKIRKLRRKAQVVVDHVDIIKDEFWEKRPWILSGTPGKLPA*
Coding >Pro_DTO377G3_2|g5860.t1
ATGGCAAATTCTAGATTTGAGTACGTCAAGTCCTTTGAGCAGCCGGACGTGCTGCTCCCCAGTACGTGGATTGTG
GTCCGCATTGATGGACGAGGATTTCACAAACTCTCTGATCACTACGCTTTCGCGAAACCCAATGACCGCCGGGCA
CTGGATCTGATGAATGCTGCGGCAGTTGAGGTCATGAAAGAGCTTCCAGACCTATGTATCGCCTATGGAGTCAGT
GACGAATTCAGTTTTGTCTTTCATCCCAACTGCCAACTTTTTGAGCGGCGTAATGGGAAACTAGTTACCACCATC
GTCTCTACATTCACAGCACACTACATTTACAAATGGAGCGAGTTCTTCCCCGAAAGACCTCTCCTGCCACCGTAT
CTACCCTCTTTCGATGGGCGTGCGGTCATCTACCCGAATAACCAAATTCTCCGCGATTATATGAGCTGGAGACAG
GTTGATTGTCACATCAATAACCTCTACAACACTACCTTCTGGACAATGGTGTTGCAAGGCGGAATGAGCAATACA
GACGCCGAGCAAGAGCTAAAGGGTACTGTATCCGCCGACAAGAACGAGATTCTCTTCAAGCGGTTTGGAATTAAC
TACAATAACGAGCTAGAGATCTATAAAAAGGGCACTGTTCTTTATCGCCAGTACGAGCTAGAGGAACCAAAGCCT
ACAAAATCACCTGCGGGCGAAGAATCACTGGTGGTCGAATCTAAGCAGTCAAGGTCACAGCAAGACAAGATCCGC
AAACTGCGCCGGAAAGCACAGGTCGTGGTTGACCATGTCGACATCATCAAAGATGAGTTCTGGGAGAAACGACCG
TGGATTCTATCAGGTACTCCTGGAAAATTACCAGCGTAG
Transcript >Pro_DTO377G3_2|g5860.t1
ATGGCAAATTCTAGATTTGAGTACGTCAAGTCCTTTGAGCAGCCGGACGTGCTGCTCCCCAGTACGTGGATTGTG
GTCCGCATTGATGGACGAGGATTTCACAAACTCTCTGATCACTACGCTTTCGCGAAACCCAATGACCGCCGGGCA
CTGGATCTGATGAATGCTGCGGCAGTTGAGGTCATGAAAGAGCTTCCAGACCTATGTATCGCCTATGGAGTCAGT
GACGAATTCAGTTTTGTCTTTCATCCCAACTGCCAACTTTTTGAGCGGCGTAATGGGAAACTAGTTACCACCATC
GTCTCTACATTCACAGCACACTACATTTACAAATGGAGCGAGTTCTTCCCCGAAAGACCTCTCCTGCCACCGTAT
CTACCCTCTTTCGATGGGCGTGCGGTCATCTACCCGAATAACCAAATTCTCCGCGATTATATGAGCTGGAGACAG
GTTGATTGTCACATCAATAACCTCTACAACACTACCTTCTGGACAATGGTGTTGCAAGGCGGAATGAGCAATACA
GACGCCGAGCAAGAGCTAAAGGGTACTGTATCCGCCGACAAGAACGAGATTCTCTTCAAGCGGTTTGGAATTAAC
TACAATAACGAGCTAGAGATCTATAAAAAGGGCACTGTTCTTTATCGCCAGTACGAGCTAGAGGAACCAAAGCCT
ACAAAATCACCTGCGGGCGAAGAATCACTGGTGGTCGAATCTAAGCAGTCAAGGTCACAGCAAGACAAGATCCGC
AAACTGCGCCGGAAAGCACAGGTCGTGGTTGACCATGTCGACATCATCAAAGATGAGTTCTGGGAGAAACGACCG
TGGATTCTATCAGGTACTCCTGGAAAATTACCAGCGTAG
Gene >Pro_DTO377G3_2|g5860.t1
ATGGCAAATTCTAGGTAAGCATTGAAAATTCTAGAAAATTTCAGTCCGGCTACTAAAAGAACACAGATTTGAGTA
CGTCAAGTCCTTTGAGCAGCCGGACGTGCTGCTCCCCAGTACGTGGATTGTGGTCCGCATTGATGGACGAGGATT
TCACAAGTGAGTCTCCATCTCTTGTCACTTGGGAATGCCCTATGCATGAGGAATCCTCATAGAAGAAGAAAATGG
CAACTATATATCCGTCTTCATGCGTATCTTTCACCAAGATATGACGCTATGACTGCTGTTCTAGTTCATGCTCTC
ATTTCTCTTCGGAGTCTAACCTATATAGACTCTCTGATCACTACGCTTTCGCGAAACCCAATGACCGCCGGGCAC
TGGATCTGATGAATGCTGCGGCAGTTGAGGTCATGAAAGAGCTTCCAGACCTATGTATCGCCTATGGAGTCAGTG
ACGAATTCAGGTATGTCCAGGTCTTTTCATCGCTATCTTCGCAAATACTAACAGTCTTCCTTCAGTTTTGTCTTT
CATCCCAACTGCCAACTTTTTGAGCGGCGTAATGGGTGAGTATTTTCTCTTTGCTTCTATCGTGCAGTGGTATAA
GAACGGCCATTGATAGAACCTCTTCCATCCAGGAAACTAGTTACCACCATCGTCTCTACATTCACAGCACACTAC
ATTTACAAATGGAGCGAGTTCTTCCCCGAAAGACCTCTCCTGCCACCGTATCTACCCTCTTTCGATGGGCGTGCG
GTCATCTACCCGAATAACCAAATTCTCCGCGATTATATGAGCTGGAGACAGGTTGATTGTAAGTGGCCTCGGAAT
GCCCTGGTTTCGGGCTACATCCGGCTAACCCAATATCACTAGGTCACATCAATAACCTCTACAACACTACCTTCT
GGACAATGGTGTTGCAAGGCGGAATGAGCAATACAGACGCCGAGCAAGAGCTAAAGGTATGCTATTGTTCCTTTC
AGTTCAAAGTACAGGCAATTGACTTGATACCAGGGTACTGTATCCGCCGACAAGAACGAGATTCTCTTCAAGCGG
TTTGGAATTAACTACAATAACGAGCTAGAGATCTATAAAAAGGGCACTGTTCTTTATCGCCAGGTATGTCCTAGT
TTATAAGTGTTTCTTTCTGTCTCGGCCGTTCTAATATTTCTCTACAGTACGAGCTAGAGGAACCAAAGCCTACAA
AATCACCTGCGGGCGAAGAATCACTGGTGGTCGAATCTAAGCAGTCAAGGTCACAGCAAGACAAGATCCGCAAAC
TGCGCCGGAAAGCACAGGTCGTGGTTGACCATGTCGACATCATCAAAGATGAGTTCTGGGAGAAACGACCGTGGA
TTCTATCAGGTACTCCTGGAAAATTACCAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail