Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5831.t1
Gene name
Locationscaffold_14:563861..565210
Strand-
Gene length (bp)1349
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00191 Annexin Annexin 2.8E-18 138 201
PF00191 Annexin Annexin 1.2E-12 209 263
PF00191 Annexin Annexin 8.4E-11 299 350
PF00191 Annexin Annexin 8.1E-13 362 428

GO

GO Term Description Terminal node
GO:0005544 calcium-dependent phospholipid binding Yes
GO:0005509 calcium ion binding Yes
GO:0008289 lipid binding No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0005543 phospholipid binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5831.t1
MSYQPNQAPYGGYAPQYGQQGPPQGGYQQPYGAPPPQGHYPPPQQGHYPPPQQGHYGAPPPQGAPYGAPPPQPHG
YHAPPAQPPYGQQPHGYAPPGQPPVGYGAPPSGGGFPPQGIPSQPSPGYIPGQLAPGEFRPQADALRKAMKGFGT
DEKALIAVLAPLDPLQMAAVRDTYSKHLGRDLFKDVKSETSGYFGDGLLAVLDGPLMNDVDNLHSAIDGAGTKEW
LLNEILLGRSNADMNAIRTAYEMRHRRSLSKDVEGDLSFKTSTLFAIVLRAARHEESTPINPQTIETDVRSVQGK
NVTEVCAIFAQASNAELRAISQTFESRYHISLEKHIEKAFSGHMEDALLLMLRTATDPAMRDAILLEQSMSGMGT
KDERLIIRVVRVHWNRNHKEMVKRAYQHKFGKSLIDRVRGETSGDYQRLMVALLE*
Coding >Pro_DTO377G3_2|g5831.t1
ATGTCTTACCAACCTAACCAAGCTCCGTATGGAGGATACGCGCCCCAATACGGACAGCAAGGCCCGCCTCAGGGG
GGCTATCAGCAGCCCTATGGTGCCCCTCCCCCGCAGGGCCACTATCCCCCGCCTCAGCAGGGACATTATCCTCCC
CCCCAGCAAGGCCACTACGGTGCGCCTCCTCCGCAGGGAGCTCCTTACGGCGCGCCACCTCCTCAACCCCACGGA
TACCATGCGCCGCCGGCGCAACCCCCATACGGCCAGCAGCCACATGGCTATGCCCCTCCGGGCCAACCACCCGTT
GGTTACGGCGCACCACCATCCGGCGGCGGTTTTCCACCCCAGGGTATTCCGTCACAGCCGTCTCCCGGCTACATC
CCTGGTCAACTAGCACCAGGCGAGTTCCGGCCCCAAGCAGATGCGCTTCGCAAAGCAATGAAGGGCTTCGGCACA
GATGAGAAGGCTTTGATTGCAGTCCTCGCGCCGCTCGATCCGCTTCAGATGGCCGCTGTCCGCGACACATACTCC
AAGCACCTTGGCCGCGATCTGTTCAAGGATGTCAAGTCTGAGACCAGCGGGTACTTCGGCGATGGCCTACTTGCC
GTGCTGGATGGACCGCTTATGAATGATGTCGACAACTTGCACTCGGCAATCGATGGTGCTGGCACGAAGGAGTGG
TTACTCAATGAGATCCTGCTCGGTCGGTCCAATGCTGATATGAATGCTATCCGGACCGCCTATGAAATGCGACAC
AGGCGTTCGCTTTCTAAAGATGTCGAAGGCGATCTCTCTTTCAAGACGTCCACTCTGTTCGCCATTGTCCTTCGT
GCTGCTCGCCATGAAGAGTCTACCCCTATCAACCCGCAAACCATCGAGACTGATGTTCGCTCCGTGCAAGGGAAG
AACGTCACAGAGGTTTGCGCAATCTTTGCCCAGGCCTCCAATGCCGAACTCCGCGCTATTAGCCAGACTTTCGAG
TCACGCTACCATATCTCTCTCGAGAAGCATATTGAGAAGGCATTCTCGGGTCATATGGAAGATGCCCTGCTCCTG
ATGCTCCGCACGGCCACGGATCCTGCCATGCGTGATGCTATCCTACTCGAGCAATCCATGAGCGGCATGGGCACC
AAGGACGAGCGCCTTATTATCCGTGTAGTCCGGGTCCACTGGAATCGCAATCACAAGGAGATGGTTAAGCGCGCT
TACCAACACAAGTTCGGGAAGAGCTTGATTGACCGCGTCCGTGGAGAGACTTCTGGTGATTACCAGCGATTGATG
GTTGCCCTTCTTGAGTAG
Transcript >Pro_DTO377G3_2|g5831.t1
ATGTCTTACCAACCTAACCAAGCTCCGTATGGAGGATACGCGCCCCAATACGGACAGCAAGGCCCGCCTCAGGGG
GGCTATCAGCAGCCCTATGGTGCCCCTCCCCCGCAGGGCCACTATCCCCCGCCTCAGCAGGGACATTATCCTCCC
CCCCAGCAAGGCCACTACGGTGCGCCTCCTCCGCAGGGAGCTCCTTACGGCGCGCCACCTCCTCAACCCCACGGA
TACCATGCGCCGCCGGCGCAACCCCCATACGGCCAGCAGCCACATGGCTATGCCCCTCCGGGCCAACCACCCGTT
GGTTACGGCGCACCACCATCCGGCGGCGGTTTTCCACCCCAGGGTATTCCGTCACAGCCGTCTCCCGGCTACATC
CCTGGTCAACTAGCACCAGGCGAGTTCCGGCCCCAAGCAGATGCGCTTCGCAAAGCAATGAAGGGCTTCGGCACA
GATGAGAAGGCTTTGATTGCAGTCCTCGCGCCGCTCGATCCGCTTCAGATGGCCGCTGTCCGCGACACATACTCC
AAGCACCTTGGCCGCGATCTGTTCAAGGATGTCAAGTCTGAGACCAGCGGGTACTTCGGCGATGGCCTACTTGCC
GTGCTGGATGGACCGCTTATGAATGATGTCGACAACTTGCACTCGGCAATCGATGGTGCTGGCACGAAGGAGTGG
TTACTCAATGAGATCCTGCTCGGTCGGTCCAATGCTGATATGAATGCTATCCGGACCGCCTATGAAATGCGACAC
AGGCGTTCGCTTTCTAAAGATGTCGAAGGCGATCTCTCTTTCAAGACGTCCACTCTGTTCGCCATTGTCCTTCGT
GCTGCTCGCCATGAAGAGTCTACCCCTATCAACCCGCAAACCATCGAGACTGATGTTCGCTCCGTGCAAGGGAAG
AACGTCACAGAGGTTTGCGCAATCTTTGCCCAGGCCTCCAATGCCGAACTCCGCGCTATTAGCCAGACTTTCGAG
TCACGCTACCATATCTCTCTCGAGAAGCATATTGAGAAGGCATTCTCGGGTCATATGGAAGATGCCCTGCTCCTG
ATGCTCCGCACGGCCACGGATCCTGCCATGCGTGATGCTATCCTACTCGAGCAATCCATGAGCGGCATGGGCACC
AAGGACGAGCGCCTTATTATCCGTGTAGTCCGGGTCCACTGGAATCGCAATCACAAGGAGATGGTTAAGCGCGCT
TACCAACACAAGTTCGGGAAGAGCTTGATTGACCGCGTCCGTGGAGAGACTTCTGGTGATTACCAGCGATTGATG
GTTGCCCTTCTTGAGTAG
Gene >Pro_DTO377G3_2|g5831.t1
ATGTCTTACCAACCTAACCGTGAGTGGCATTTCAAATACATTTCCAGTCTTGACAGGAGCTAACTCAGTCAATAG
AAGCTCCGTATGGAGGATACGCGCCCCAATACGGACAGCAAGGCCCGCCTCAGGGGGGCTATCAGCAGCCCTATG
GTGCCCCTCCCCCGCAGGGCCACTATCCCCCGCCTCAGCAGGGACATTATCCTCCCCCCCAGCAAGGCCACTACG
GTGCGCCTCCTCCGCAGGGAGCTCCTTACGGCGCGCCACCTCCTCAACCCCACGGATACCATGCGCCGCCGGCGC
AACCCCCATACGGCCAGCAGCCACATGGCTATGCCCCTCCGGGCCAACCACCCGTTGGTTACGGCGCACCACCAT
CCGGCGGCGGTTTTCCACCCCAGGGTATTCCGTCACAGCCGTCTCCCGGCTACATCCCTGGTCAACTAGCACCAG
GCGAGTTCCGGCCCCAAGCAGATGCGCTTCGCAAAGCAATGAAGGGCTTCGGCACAGATGAGAAGGCTTTGATTG
CAGTCCTCGCGCCGCTCGATCCGCTTCAGATGGCCGCTGTCCGCGACACATACTCCAAGCACCTTGGCCGCGATC
TGTTCAAGGATGTCAAGTCTGAGACCAGCGGGTACTTCGGCGATGGCCTACTTGCCGTGCTGGATGGACCGCTTA
TGAATGATGTCGACAACTTGCACTCGGCAATCGATGGTGCTGGCACGAAGGAGTGGTTACTCAATGAGATCCTGC
TCGGTCGGTCCAATGCTGATATGAATGCTATCCGGACCGCCTATGAAATGCGACACAGGCGTTCGCTTTCTAAAG
ATGTCGAAGGCGATCTCTCTTTCAAGACGTCCACTCTGTTCGCCATTGTCCTTCGTGCTGCTCGCCATGAAGAGT
CTACCCCTATCAACCCGCAAACCATCGAGACTGATGTTCGCTCCGTGCAAGGGAAGAACGTCACAGAGGTTTGCG
CAATCTTTGCCCAGGCCTCCAATGCCGAACTCCGCGCTATTAGCCAGACTTTCGAGTCACGCTACCATATCTCTC
TCGAGAAGCATATTGAGAAGGCATTCTCGGGTCATATGGAAGATGCCCTGCTCCTGATGCTCCGCACGGCCACGG
ATCCTGCCATGCGTGATGCTATCCTACTCGAGCAATCCATGAGCGGCATGGGCACCAAGGACGAGCGCCTTATTA
TCCGTGTAGTCCGGGTCCACTGGAATCGCAATCACAAGGAGATGGTTAAGCGCGCTTACCAACACAAGTTCGGGA
AGAGCTTGATTGACCGCGTCCGTGGAGAGACTTCTGGTGATTACCAGCGATTGATGGTTGCCCTTCTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail