Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5804.t1
Gene name
Locationscaffold_14:487932..490394
Strand-
Gene length (bp)2462
Transcript length (bp)2214
Coding sequence length (bp)2214
Protein length (aa) 738

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01480 PWI PWI domain 1.5E-11 11 73
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.5E-05 370 413

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0003723 RNA binding Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008150 biological_process No
GO:0006396 RNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 47.55 29.15 65.95
5d_25C Five days - 25 degrees Celsius 49.25 30.17 68.33
7d_25C Seven days - 25 degrees Celsius 47.39 29.01 65.77
10d_25C Ten days - 25 degrees Celsius 48.54 29.72 67.37
7d_15C Seven days - 15 degrees Celsius 48.12 29.47 66.78
7d_30C Seven days - 30 degrees Celsius 49.72 30.43 69.01

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.914614 no
3d_25C 7d_25C 0.992383 no
3d_25C 7d_15C 0.973090 no
3d_25C 7d_30C 0.890027 no
3d_25C 10d_25C 0.952800 no
5d_25C 7d_25C 0.907692 no
5d_25C 7d_15C 0.946035 no
5d_25C 7d_30C 0.979204 no
5d_25C 10d_25C 0.968333 no
7d_25C 7d_15C 0.965024 no
7d_25C 7d_30C 0.881142 no
7d_25C 10d_25C 0.945067 no
7d_15C 7d_30C 0.922745 no
7d_15C 10d_25C 0.979885 no
7d_30C 10d_25C 0.945320 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5804.t1
MQFTDAEAADVKKWVVKKLEDISDADSDVLADYVLALVRSDAPAEEIKKISVENLEDFLREHTQPFVTELFTTFG
PKQPAPPTPAPAPQPQRQPQPAAQIPLSQPPENAPSGPRATVTPGSANRKRTFNEGFQGEPDHDDSGFQNRAIKT
ARRGGRGGSRGDFMGGQHMQAGQQYPPQQAGQLFPLQQQGQQFPSQQQGQQFPPHQQGQQFPPQQPGGFPMMPGF
PPFDPNDPMAAMMAMQSMQGMGFPPMPGMPMPGMPGPPGQPGADQIPKSNQRCPFYDTQGICYLGNTCPYQHGEG
VSKDDEYDPKTAGTHAQRGGAPSRGDRGRGRGRGGFSGRGRGRSDFSSAGPNEDQSVTTIVVEQIPDDKFNEDSV
REFFSEFGKITEVSLQPYKKVALVKYETFPEAKAAWSSPKVIFDNRFVKVYWYKPNRDETHDSAQPEAPAFNKEE
FEKQQQEAQRAHEEKMKKRQETEAAKQALERQRDELIKKQQEERARLMQRLGGTTDTNGATGGGDAMATEPPADE
NISAETKQLRAQLAALEAEAKSLGLDPAADPSARGGYRGRGGFRGRGTYRGRGAYDPNFRGGYRGRGGFAARGRG
GVLRLDNRPRRVAVSGVELNSDKDEALRQHLMGVGEYESIEAHPDQPNSVVVAFKERFQAEKLMFSPWNIPSVGE
VQLTWVPNPPVVLPTAGSSTEFKGGIGQDEPEDTVMSSSSVANSAPARDMDYDVAEDDSWGA*
Coding >Pro_DTO377G3_2|g5804.t1
ATGCAGTTTACTGATGCAGAAGCCGCTGACGTAAAGAAATGGGTGGTAAAAAAACTGGAGGACATCTCGGATGCC
GACTCCGACGTGCTCGCAGACTATGTTTTGGCGCTAGTTAGGTCCGATGCGCCAGCCGAGGAAATCAAGAAGATC
TCGGTGGAAAACTTGGAGGATTTCCTGCGCGAACACACTCAACCGTTCGTTACCGAGCTCTTTACAACATTCGGT
CCCAAACAACCCGCACCTCCTACGCCCGCGCCTGCACCCCAGCCTCAGCGCCAGCCCCAACCTGCTGCCCAGATT
CCTTTGTCACAGCCTCCTGAGAATGCCCCCAGCGGCCCGAGAGCTACCGTCACCCCGGGCAGTGCCAACCGGAAA
CGAACTTTCAATGAGGGATTCCAGGGGGAGCCGGATCACGACGATAGTGGGTTCCAGAATCGCGCTATCAAGACT
GCACGGCGTGGTGGGCGCGGAGGTAGTCGCGGCGACTTCATGGGCGGACAACATATGCAAGCGGGTCAACAATAT
CCTCCACAACAAGCGGGTCAACTGTTTCCTCTGCAGCAACAAGGCCAGCAATTCCCCTCTCAGCAACAAGGCCAG
CAATTCCCCCCGCATCAGCAGGGCCAACAGTTCCCTCCGCAGCAGCCCGGTGGCTTCCCTATGATGCCAGGTTTC
CCACCGTTCGACCCCAATGACCCTATGGCAGCAATGATGGCTATGCAGAGTATGCAAGGTATGGGATTCCCGCCG
ATGCCGGGGATGCCTATGCCCGGGATGCCCGGTCCTCCCGGTCAGCCAGGAGCCGATCAGATCCCGAAAAGCAAC
CAGCGATGTCCATTCTATGATACCCAAGGTATCTGTTACCTAGGAAACACTTGCCCTTACCAGCACGGCGAGGGA
GTCTCGAAAGACGATGAATATGACCCCAAGACCGCGGGTACGCATGCGCAGCGGGGCGGTGCTCCTTCGCGCGGT
GACCGTGGCCGCGGCCGTGGTCGCGGCGGGTTCAGCGGACGAGGACGCGGCCGGTCCGATTTCTCATCGGCAGGA
CCTAATGAAGATCAGTCTGTTACGACTATTGTTGTTGAGCAGATTCCCGACGACAAGTTCAACGAGGATTCTGTG
CGCGAGTTCTTCTCCGAGTTCGGTAAGATCACCGAGGTTTCTTTGCAACCCTACAAAAAGGTGGCTTTGGTCAAA
TACGAGACTTTCCCGGAAGCCAAGGCTGCGTGGTCTAGTCCCAAGGTTATCTTCGACAACCGCTTCGTGAAGGTT
TACTGGTACAAACCGAATCGCGATGAGACGCACGACAGTGCACAACCGGAGGCCCCAGCCTTCAACAAAGAAGAG
TTCGAGAAGCAACAACAAGAAGCACAGAGGGCGCACGAGGAGAAAATGAAAAAGCGACAGGAGACCGAAGCAGCC
AAGCAGGCTCTAGAACGCCAGCGCGATGAACTTATCAAGAAACAGCAGGAGGAGCGGGCCCGTCTCATGCAGCGA
CTTGGAGGCACGACAGACACAAACGGTGCCACCGGTGGTGGAGACGCTATGGCCACCGAGCCTCCAGCTGACGAG
AATATCAGTGCTGAGACGAAACAGCTGCGAGCTCAACTGGCTGCTCTCGAGGCGGAGGCAAAGAGTCTTGGTCTC
GACCCTGCGGCGGACCCTTCAGCGCGGGGTGGCTACCGGGGTCGTGGTGGCTTCCGCGGCCGAGGCACGTACCGT
GGACGCGGCGCTTACGATCCCAACTTCCGCGGAGGATATCGTGGACGCGGTGGATTTGCGGCTCGGGGACGGGGA
GGTGTACTGCGTCTGGATAACCGGCCTCGACGAGTCGCCGTATCGGGCGTTGAGCTCAACTCAGACAAGGACGAG
GCATTGCGTCAGCACCTGATGGGCGTTGGCGAATACGAATCCATCGAGGCACACCCAGACCAGCCAAACTCGGTC
GTGGTGGCATTCAAAGAGCGCTTCCAGGCCGAGAAGCTAATGTTCTCCCCGTGGAACATCCCCTCCGTGGGCGAG
GTTCAACTCACCTGGGTGCCCAATCCGCCCGTTGTACTTCCTACCGCTGGGTCATCCACGGAATTCAAGGGTGGT
ATTGGACAGGACGAACCGGAAGACACAGTCATGTCGTCTTCGTCGGTGGCCAACAGCGCTCCTGCGCGGGATATG
GATTACGACGTTGCGGAGGATGACAGCTGGGGCGCTTAA
Transcript >Pro_DTO377G3_2|g5804.t1
ATGCAGTTTACTGATGCAGAAGCCGCTGACGTAAAGAAATGGGTGGTAAAAAAACTGGAGGACATCTCGGATGCC
GACTCCGACGTGCTCGCAGACTATGTTTTGGCGCTAGTTAGGTCCGATGCGCCAGCCGAGGAAATCAAGAAGATC
TCGGTGGAAAACTTGGAGGATTTCCTGCGCGAACACACTCAACCGTTCGTTACCGAGCTCTTTACAACATTCGGT
CCCAAACAACCCGCACCTCCTACGCCCGCGCCTGCACCCCAGCCTCAGCGCCAGCCCCAACCTGCTGCCCAGATT
CCTTTGTCACAGCCTCCTGAGAATGCCCCCAGCGGCCCGAGAGCTACCGTCACCCCGGGCAGTGCCAACCGGAAA
CGAACTTTCAATGAGGGATTCCAGGGGGAGCCGGATCACGACGATAGTGGGTTCCAGAATCGCGCTATCAAGACT
GCACGGCGTGGTGGGCGCGGAGGTAGTCGCGGCGACTTCATGGGCGGACAACATATGCAAGCGGGTCAACAATAT
CCTCCACAACAAGCGGGTCAACTGTTTCCTCTGCAGCAACAAGGCCAGCAATTCCCCTCTCAGCAACAAGGCCAG
CAATTCCCCCCGCATCAGCAGGGCCAACAGTTCCCTCCGCAGCAGCCCGGTGGCTTCCCTATGATGCCAGGTTTC
CCACCGTTCGACCCCAATGACCCTATGGCAGCAATGATGGCTATGCAGAGTATGCAAGGTATGGGATTCCCGCCG
ATGCCGGGGATGCCTATGCCCGGGATGCCCGGTCCTCCCGGTCAGCCAGGAGCCGATCAGATCCCGAAAAGCAAC
CAGCGATGTCCATTCTATGATACCCAAGGTATCTGTTACCTAGGAAACACTTGCCCTTACCAGCACGGCGAGGGA
GTCTCGAAAGACGATGAATATGACCCCAAGACCGCGGGTACGCATGCGCAGCGGGGCGGTGCTCCTTCGCGCGGT
GACCGTGGCCGCGGCCGTGGTCGCGGCGGGTTCAGCGGACGAGGACGCGGCCGGTCCGATTTCTCATCGGCAGGA
CCTAATGAAGATCAGTCTGTTACGACTATTGTTGTTGAGCAGATTCCCGACGACAAGTTCAACGAGGATTCTGTG
CGCGAGTTCTTCTCCGAGTTCGGTAAGATCACCGAGGTTTCTTTGCAACCCTACAAAAAGGTGGCTTTGGTCAAA
TACGAGACTTTCCCGGAAGCCAAGGCTGCGTGGTCTAGTCCCAAGGTTATCTTCGACAACCGCTTCGTGAAGGTT
TACTGGTACAAACCGAATCGCGATGAGACGCACGACAGTGCACAACCGGAGGCCCCAGCCTTCAACAAAGAAGAG
TTCGAGAAGCAACAACAAGAAGCACAGAGGGCGCACGAGGAGAAAATGAAAAAGCGACAGGAGACCGAAGCAGCC
AAGCAGGCTCTAGAACGCCAGCGCGATGAACTTATCAAGAAACAGCAGGAGGAGCGGGCCCGTCTCATGCAGCGA
CTTGGAGGCACGACAGACACAAACGGTGCCACCGGTGGTGGAGACGCTATGGCCACCGAGCCTCCAGCTGACGAG
AATATCAGTGCTGAGACGAAACAGCTGCGAGCTCAACTGGCTGCTCTCGAGGCGGAGGCAAAGAGTCTTGGTCTC
GACCCTGCGGCGGACCCTTCAGCGCGGGGTGGCTACCGGGGTCGTGGTGGCTTCCGCGGCCGAGGCACGTACCGT
GGACGCGGCGCTTACGATCCCAACTTCCGCGGAGGATATCGTGGACGCGGTGGATTTGCGGCTCGGGGACGGGGA
GGTGTACTGCGTCTGGATAACCGGCCTCGACGAGTCGCCGTATCGGGCGTTGAGCTCAACTCAGACAAGGACGAG
GCATTGCGTCAGCACCTGATGGGCGTTGGCGAATACGAATCCATCGAGGCACACCCAGACCAGCCAAACTCGGTC
GTGGTGGCATTCAAAGAGCGCTTCCAGGCCGAGAAGCTAATGTTCTCCCCGTGGAACATCCCCTCCGTGGGCGAG
GTTCAACTCACCTGGGTGCCCAATCCGCCCGTTGTACTTCCTACCGCTGGGTCATCCACGGAATTCAAGGGTGGT
ATTGGACAGGACGAACCGGAAGACACAGTCATGTCGTCTTCGTCGGTGGCCAACAGCGCTCCTGCGCGGGATATG
GATTACGACGTTGCGGAGGATGACAGCTGGGGCGCTTAA
Gene >Pro_DTO377G3_2|g5804.t1
ATGCAGTTTACTGATGCAGAAGCCGCTGACGTAAAGAAATGGGTGGTAAAAAAACTGGAGGACATGTGAGTTGAT
CAGGCACCAGAATCGGGGACTGAGACCCGTGGATTGCCCTAGGGGAAGCAAACTGAGACTAATTGGCTTTATTCT
GTCTTTAGCTCGGATGCCGACTCCGACGTGCTCGCAGACTATGTTTTGGCGCTAGTTAGGTCCGATGCGCCAGCC
GAGGAAATCAAGAAGATCTCGGTGGAAAACTTGGAGGATTTCCTGCGCGAACGTGAGTCCATATCTCAATCCCGA
ATTGTTTCATACAACTAACAACTCTTAGACACTCAACCGTTCGTTACCGAGCTCTTTACAACATTCGGTCCCAAA
CAACCCGCACCTCCTACGCCCGCGCCTGCACCCCAGCCTCAGCGCCAGCCCCAACCTGCTGCCCAGATTCCTTTG
TCACAGCCTCCTGAGAATGCCCCCAGCGGCCCGAGAGCTACCGTCACCCCGGGCAGTGCCAACCGGAAACGAACT
TTCAATGAGGGATTCCAGGGGGAGCCGGATCACGACGATAGTGGGTTCCAGAATCGCGCTATCAAGACTGCACGG
CGTGGTGGGCGCGGAGGTAGTCGCGGCGACTTCATGGGCGGACAACATATGCAAGCGGGTCAACAATATCCTCCA
CAACAAGCGGGTCAACTGTTTCCTCTGCAGCAACAAGGCCAGCAATTCCCCTCTCAGCAACAAGGCCAGCAATTC
CCCCCGCATCAGCAGGGCCAACAGTTCCCTCCGCAGCAGCCCGGTGGCTTCCCTATGATGCCAGGTTTCCCACCG
TTCGACCCCAATGACCCTATGGCAGCAATGATGGCTATGCAGAGTATGCAAGGTATGGGATTCCCGCCGATGCCG
GGGATGCCTATGCCCGGGATGCCCGGTCCTCCCGGTCAGCCAGGAGCCGATCAGATCCCGAAAAGCAACCAGCGA
TGTCCATTCTATGATACCCAAGGTATCTGTTACCTAGGAAACACTTGCCCTTACCAGCACGGCGAGGGAGTCTCG
AAAGACGATGGTAAGAACAATTCATTTATCCTAGATATACCATTGCTAACAATCGCAGAATATGACCCCAAGACC
GCGGGTACGCATGCGCAGCGGGGCGGTGCTCCTTCGCGCGGTGACCGTGGCCGCGGCCGTGGTCGCGGCGGGTTC
AGCGGACGAGGACGCGGCCGGTCCGATTTCTCATCGGCAGGACCTAATGAAGATCAGTCTGTTACGACTATTGTT
GTTGAGCAGATTCCCGACGACAAGTTCAACGAGGATTCTGTGCGCGAGTTCTTCTCCGAGTTCGGTAAGATCACC
GAGGTTTCTTTGCAACCCTACAAAAAGGTGGCTTTGGTCAAATACGAGACTTTCCCGGAAGCCAAGGCTGCGTGG
TCTAGTCCCAAGGTTATCTTCGACAACCGCTTCGTGAAGGTTTACTGGTACAAACCGAATCGCGATGAGACGCAC
GACAGTGCACAACCGGAGGCCCCAGCCTTCAACAAAGAAGAGTTCGAGAAGCAACAACAAGAAGCACAGAGGGCG
CACGAGGAGAAAATGAAAAAGCGACAGGAGACCGAAGCAGCCAAGCAGGCTCTAGAACGCCAGCGCGATGAACTT
ATCAAGAAACAGCAGGAGGAGCGGGCCCGTCTCATGCAGCGACTTGGAGGCACGACAGACACAAACGGTGCCACC
GGTGGTGGAGACGCTATGGCCACCGAGCCTCCAGCTGACGAGAATATCAGTGCTGAGACGAAACAGCTGCGAGCT
CAACTGGCTGCTCTCGAGGCGGAGGCAAAGAGTCTTGGTCTCGACCCTGCGGCGGACCCTTCAGCGCGGGGTGGC
TACCGGGGTCGTGGTGGCTTCCGCGGCCGAGGCACGTACCGTGGACGCGGCGCTTACGATCCCAACTTCCGCGGA
GGATATCGTGGACGCGGTGGATTTGCGGCTCGGGGACGGGGAGGTGTACTGCGTCTGGATAACCGGCCTCGACGA
GTCGCCGTATCGGGCGTTGAGCTCAACTCAGACAAGGACGAGGCATTGCGTCAGCACCTGATGGTAAGTTATGTA
TCTTTCTAACCAAGCAAAGCGTGTACTAATTTGTTGTGTTCTAGGGCGTTGGCGAATACGAATCCATCGAGGCAC
ACCCAGACCAGCCAAACTCGGTCGTGGTGGCATTCAAAGAGCGCTTCCAGGCCGAGAAGCTAATGTTCTCCCCGT
GGAACATCCCCTCCGTGGGCGAGGTTCAACTCACCTGGGTGCCCAATCCGCCCGTTGTACTTCCTACCGCTGGGT
CATCCACGGAATTCAAGGGTGGTATTGGACAGGACGAACCGGAAGACACAGTCATGTCGTCTTCGTCGGTGGCCA
ACAGCGCTCCTGCGCGGGATATGGATTACGACGTTGCGGAGGATGACAGCTGGGGCGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail