Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5800.t1
Gene name
Locationscaffold_14:480540..482480
Strand-
Gene length (bp)1940
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-41 76 476
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.1E-09 105 249
PF00083 Sugar_tr Sugar (and other) transporter 9.5E-07 90 259

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 69 88 19
2 103 125 22
3 132 154 22
4 158 180 22
5 192 214 22
6 219 241 22
7 321 343 22
8 358 377 19
9 397 419 22
10 424 446 22
11 467 484 17
12 494 513 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5800.t1
MARNEETTKSLCGSQDIEFRYLELETPLPTPCITLPPGPAQSPPPEAPSLEKFISPFLWPKWRKSMMTYIACGVT
ALAGYAAGEVSPASEELTKLWGVSTVVYNLSITIFCCGFALAPMALAPFSEINGRRPIFIASGILFVACLIGCGG
TPSFAGLLIARFFLGVGGSTFSTMVGGVISDIYHAQDRNTPMALFSASALFGTGLAPMISGAIISRTTWRWVFYS
HAIVSAAFVIIIYFFFRETRGSVLLSRKAATLNKYYERLEEAGHHGVILPGEEASEEKCVRRIRWKVKSDEQRES
IVTMIQISLYRPFHMLFTEPVVFFFSLWVSFSWAVLYLQFSSIPLVFRTNYNFTIEQTGAVFTSMCVGTILITII
SIYQDRIAMRFGKNSTSPEARLHFVCIESVLLPIGLFWFGWSSFPSVHWIVPALAIGCATMGIFSIYLATFNYLA
DTYHRYASSAIAAQSCCRNLLGGIFPLVTNAMFTNLGYPEASSLLGGLGAALTLVPWVLIFYGPKIRARSKLASE
LAH*
Coding >Pro_DTO377G3_2|g5800.t1
ATGGCAAGAAACGAGGAGACTACCAAGTCTCTATGCGGATCTCAAGATATCGAATTCCGCTATCTAGAGCTAGAG
ACACCCTTACCGACCCCATGCATTACTTTACCACCCGGCCCCGCTCAGTCACCACCACCAGAAGCGCCCAGTCTA
GAGAAATTCATCTCTCCCTTTCTGTGGCCAAAATGGCGCAAGTCCATGATGACTTATATCGCTTGCGGGGTCACT
GCGCTAGCAGGTTATGCTGCGGGCGAGGTCAGTCCTGCATCAGAGGAACTAACTAAATTATGGGGGGTCAGTACC
GTCGTTTACAATTTGAGCATCACGATTTTCTGTTGTGGGTTTGCCCTGGCGCCGATGGCGCTGGCTCCCTTTTCT
GAGATTAATGGACGGAGGCCGATCTTTATCGCCAGTGGGATTCTCTTCGTTGCCTGTTTAATCGGCTGTGGAGGC
ACGCCGTCCTTTGCTGGATTGCTTATAGCTCGTTTCTTCCTGGGTGTGGGTGGATCAACATTCTCCACTATGGTC
GGCGGCGTGATCAGCGATATCTATCATGCTCAAGATCGGAACACGCCCATGGCGCTCTTCTCGGCATCTGCATTG
TTCGGTACTGGCCTGGCACCGATGATCTCCGGCGCAATCATCTCCCGCACCACATGGCGCTGGGTGTTCTACTCG
CACGCAATTGTGTCCGCTGCTTTTGTCATTATCATCTACTTCTTCTTCAGAGAAACGCGCGGCAGTGTCCTGCTA
AGCCGCAAGGCCGCAACGTTGAACAAGTACTACGAGCGACTCGAAGAAGCAGGCCATCACGGTGTAATACTGCCG
GGCGAAGAAGCGTCTGAAGAAAAATGCGTTCGTCGAATCAGGTGGAAAGTCAAGAGCGACGAGCAACGAGAATCG
ATCGTAACCATGATCCAGATCTCGCTGTACAGACCATTCCACATGCTCTTCACCGAACCCGTGGTCTTCTTCTTC
TCCCTATGGGTCTCCTTCAGCTGGGCAGTCCTCTACCTCCAATTCAGCTCCATACCACTCGTCTTCCGCACAAAC
TACAACTTCACAATCGAGCAAACCGGCGCCGTCTTCACCTCAATGTGTGTTGGCACCATCCTCATCACTATCATC
AGTATCTATCAAGATCGCATCGCCATGCGCTTCGGTAAAAACTCCACTTCTCCCGAGGCCAGACTGCACTTCGTC
TGCATCGAGTCCGTGCTTCTGCCCATTGGCCTGTTCTGGTTCGGTTGGAGTTCTTTCCCATCTGTTCACTGGATC
GTGCCTGCTTTGGCGATTGGATGTGCTACCATGGGCATCTTTTCCATTTACCTCGCTACGTTTAATTACCTCGCT
GATACATATCACCGGTATGCGAGTTCGGCGATTGCGGCGCAGTCTTGTTGTCGGAATTTGCTCGGTGGTATCTTT
CCACTGGTTACGAATGCCATGTTCACCAACCTTGGTTATCCAGAGGCATCGAGTCTGCTAGGAGGACTTGGTGCT
GCTTTGACTCTGGTTCCCTGGGTGCTGATCTTCTACGGACCCAAGATTCGAGCTAGGAGCAAGCTCGCAAGTGAA
CTCGCACATTAA
Transcript >Pro_DTO377G3_2|g5800.t1
ATGGCAAGAAACGAGGAGACTACCAAGTCTCTATGCGGATCTCAAGATATCGAATTCCGCTATCTAGAGCTAGAG
ACACCCTTACCGACCCCATGCATTACTTTACCACCCGGCCCCGCTCAGTCACCACCACCAGAAGCGCCCAGTCTA
GAGAAATTCATCTCTCCCTTTCTGTGGCCAAAATGGCGCAAGTCCATGATGACTTATATCGCTTGCGGGGTCACT
GCGCTAGCAGGTTATGCTGCGGGCGAGGTCAGTCCTGCATCAGAGGAACTAACTAAATTATGGGGGGTCAGTACC
GTCGTTTACAATTTGAGCATCACGATTTTCTGTTGTGGGTTTGCCCTGGCGCCGATGGCGCTGGCTCCCTTTTCT
GAGATTAATGGACGGAGGCCGATCTTTATCGCCAGTGGGATTCTCTTCGTTGCCTGTTTAATCGGCTGTGGAGGC
ACGCCGTCCTTTGCTGGATTGCTTATAGCTCGTTTCTTCCTGGGTGTGGGTGGATCAACATTCTCCACTATGGTC
GGCGGCGTGATCAGCGATATCTATCATGCTCAAGATCGGAACACGCCCATGGCGCTCTTCTCGGCATCTGCATTG
TTCGGTACTGGCCTGGCACCGATGATCTCCGGCGCAATCATCTCCCGCACCACATGGCGCTGGGTGTTCTACTCG
CACGCAATTGTGTCCGCTGCTTTTGTCATTATCATCTACTTCTTCTTCAGAGAAACGCGCGGCAGTGTCCTGCTA
AGCCGCAAGGCCGCAACGTTGAACAAGTACTACGAGCGACTCGAAGAAGCAGGCCATCACGGTGTAATACTGCCG
GGCGAAGAAGCGTCTGAAGAAAAATGCGTTCGTCGAATCAGGTGGAAAGTCAAGAGCGACGAGCAACGAGAATCG
ATCGTAACCATGATCCAGATCTCGCTGTACAGACCATTCCACATGCTCTTCACCGAACCCGTGGTCTTCTTCTTC
TCCCTATGGGTCTCCTTCAGCTGGGCAGTCCTCTACCTCCAATTCAGCTCCATACCACTCGTCTTCCGCACAAAC
TACAACTTCACAATCGAGCAAACCGGCGCCGTCTTCACCTCAATGTGTGTTGGCACCATCCTCATCACTATCATC
AGTATCTATCAAGATCGCATCGCCATGCGCTTCGGTAAAAACTCCACTTCTCCCGAGGCCAGACTGCACTTCGTC
TGCATCGAGTCCGTGCTTCTGCCCATTGGCCTGTTCTGGTTCGGTTGGAGTTCTTTCCCATCTGTTCACTGGATC
GTGCCTGCTTTGGCGATTGGATGTGCTACCATGGGCATCTTTTCCATTTACCTCGCTACGTTTAATTACCTCGCT
GATACATATCACCGGTATGCGAGTTCGGCGATTGCGGCGCAGTCTTGTTGTCGGAATTTGCTCGGTGGTATCTTT
CCACTGGTTACGAATGCCATGTTCACCAACCTTGGTTATCCAGAGGCATCGAGTCTGCTAGGAGGACTTGGTGCT
GCTTTGACTCTGGTTCCCTGGGTGCTGATCTTCTACGGACCCAAGATTCGAGCTAGGAGCAAGCTCGCAAGTGAA
CTCGCACATTAA
Gene >Pro_DTO377G3_2|g5800.t1
ATGGCAAGAAACGAGGAGACTACCAAGTCTCTATGCGGATCTCAAGATATCGAATTCCGCTATCTAGAGCTAGAG
ACACCCTTACCGACCCCATGCATTACTTTACCACCCGGCCCCGCTCAGTCACCACCACCAGAAGCGCCCAGTCTA
GAGAAATTCATCTCTCCCTTTCTGTGGCCAAAATGGCGCAAGTCCATGATGACTTATATCGCTTGCGGGGTCACT
GCGCTAGCAGGTTATGCTGCGGGCGAGGTCAGTCCTGCATCAGAGGAACTAACTAAATTATGGGGGGTCAGTACC
GTCGTTTACAATTTGAGCATCACGATTTTCTGTTGTGGGTTTGCCCTGGCGCCGATGGCGCTGGCTCCCTTTTCT
GAGATTAATGGACGGAGGCCGATCTTTATCGCCAGTGGGATTCTCTTCGTTGGTATGTATTACTCCGCTGTTTTA
CTCGGCATATGCTGACTTTCTATGTTAACAGCCTGTTTAATCGGCTGTGGAGGCACGCCGTCCTTTGCTGGATTG
CTTATAGCTCGTTTCTTCCTGGGTGTGGGTGGATGTATGTATAGCCTGCTCCGAATGGTCGCATTCAATTGATAC
TGACTTGAAGCCTCACAGCAACATTCTCCACTATGGTCGGCGGCGTGATCAGCGATATCTATCATGCTCAAGATC
GGAACACGCCCATGGCGCTCTTCTCGGCATCTGCATTGTTCGGTACTGGCCTGGCACCGATGATCTCCGGCGCAA
TCATCTCCCGCACCACATGGCGCTGGGTGTTCTACTCGCACGCAATTGTGTCCGCTGCTTTTGTCATTATCATCT
ACTTCTTCTTCAGAGAAACGCGCGGCAGTGTCCTGCTAAGCCGCAAGGCCGCAACGTTGAACAAGTACTACGAGC
GACTCGAAGAAGCAGGCCATCACGGTGTAATACTGCCGGGCGAAGAAGCGTCTGAAGAAAAATGCGTTCGTCGAA
TCAGGTGGAAAGTCAAGAGCGACGAGCAACGAGAATCGATCGTAACCATGATCCAGATCTCGCTGTACAGACCAT
TCCGTAAGTCTACGCTAACCTTCAGTCCACCATCCCCTAATGAATGAAAGAAAAACTAACATCCTAATCTAGACA
TGCTCTTCACCGAACCCGTGGTCTTCTTCTTCTCCCTATGGGTCTCCTTCAGCTGGGCAGTCCTCTACCTCCAAT
TCAGCTCCATACCACTCGTCTTCCGCACAAACTACAACTTCACAATCGAGCAAACCGGCGCCGTCTTCACCTCAA
TGTGTGTTGGCACCATCCTCATCACTATCATCAGTATCTATCAAGATCGCATCGCCATGCGCTTCGGTAAAAACT
CCACTTCTCCCGAGGCCAGACTGCACTTCGTCTGCATCGAGTCCGTGCTTCTGCCCATTGGCCTGTTCTGGTTCG
GTTGGAGTTCTTTCCCATCTGTTCACTGGATCGTGCCTGCTTTGGCGATTGGATGTGCTACCATGGGCATCTTTT
CCATTTACCTCGCTACGTTTAATTACCTCGCTGATACATATCACCGGTATGCGAGTTCGGCGATTGCGGCGCAGT
CTTGTTGTAAGCTTTTCCATGGGTCGTTGATTTGTATGTGATGATATTTTGCTAACGTCTTACTCACTAGGTCGG
AATTTGCTCGGTGGTATCTTTCCACTGGTTACGAATGCCATGTTCACCAACCTTGGTTATCCAGAGGCATCGAGT
CTGCTAGGAGGACTTGTAAGTTGTGGCAATTAACACCAAGAGAAGAAATCGACTGACTGGATCGAAATAGGGTGC
TGCTTTGACTCTGGTTCCCTGGGTGCTGATCTTCTACGGACCCAAGATTCGAGCTAGGAGCAAGCTCGCAAGTGT
AGGTGATGCCTTTCATTCATACACACTGTTTGAGACTAATGGAATCATAGGAACTCGCACATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail