Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5789.t1
Gene name
Locationscaffold_14:447738..455177
Strand+
Gene length (bp)7439
Transcript length (bp)7077
Coding sequence length (bp)7077
Protein length (aa) 2359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.4E-64 17 268
PF14765 PS-DH Polyketide synthase dehydratase 1.7E-57 930 1227
PF00698 Acyl_transf_1 Acyl transferase domain 1.3E-56 546 873
PF08659 KR KR domain 8.4E-47 1976 2156
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 4.7E-37 278 391
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 3.0E-18 395 512
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.2E-14 1772 1890
PF00106 adh_short short chain dehydrogenase 9.0E-11 1978 2146
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.3E-10 1809 1950
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.5E-04 1653 1712

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5789.t1
MSPILLDSSPADEGLGEAIAICGIACRLPGEVSSPREFWDLISNGRSAQCKVPKSRFNVDGFYHPQGMDRPGSMI
TEGGYFLDDDVREFENSFFGINNLEAKYMDPQQRKMLEVVYECMENAGIPLDQASGSNTGCYVGNFTVDYMVMQL
KDPDYLSRYSGTGLGTTILANRISHVFNLLGPSLLLDTACSSSLYCLHMACTALQNRECDAAIVAGANLIQSAEQ
HIATMKAGVLSGTSACHTFDTSADGYGRADGIGALYVKRLEDALRDGDPIRSLIRGSAVNANGKTSGISLPSADG
QEAVIQKAMAKGGIVPDDITFVECHGTGTKVGDAIEVEALSRVFQRTPNNPLMIGSVKSNVGHSEAASGISSVIK
STLALERGQIPPTHGLKNINPKLKVEDRNIKIPTELTNWPNHSSRVRRVGINSFGYGGANCHVILEQPTKTLSSS
RQLRQLPITQSTVILPLSAASTASLEARVADFARYEFGDTDIADLAYTLGSRRTHFAERGFLLAPRSQESSHSFQ
TRTWVTSASPVTGVASTPFAFVFTGQGSQWPGMCRELLSEFSLFRDTITEMDSVLKSLPGPPSWSLMEAILDVDN
PSLIHLPQRSQPCCTAIQVALIRLLSSWEIAPTMTVGHSSGEIAAAFAAGHVSAAEAIVIAYYRGYCVSKSTRVG
AMMAIGLSESSTTDEIAKAGLDDQIRVACVNSPEGVTVSGDENALDIFLATLQQRNIFARKLKTGGQAYHSHHMV
SIGEEYQALLERALPSLGPSIRQPQGASVMSSVTGELKSSGFTASYWRSNLESQVRFAHAIERIHELTEHCFIEL
GPHSSLELPIKQTLAKAGAELKYAAPIKRNVDSMESILSFAGNLWLKGYEINWSKVNGLQTGLKSVRSMYRVVTD
LPPYRFNYENILWNECRASVEYRQRKYPHHELLGSLLTGGNARDKIFRNILKVDDVSWLKDHKLGDTVVFPGAGY
LAMAMEAVMQATDAARTDPTFQFSNVNITNALTLNTEFSTSAEIFTSLHKSVITNAATSATWWDFAISSYHNGSA
VQHASGSIAIHPRNAALQSKYKPPSGALESTAKRTWYEKFIRQGLNYGPTFQTISEFYTPRMKSESFASATAPLL
KTSGDSISVYPVHPIALDGMIQLAVVAATNGKPKELRAQIPTRLPSAIVHTSTSSNQTCQMHAVVKRIGFGYTHA
GIEMIDSDGQIVAQFDDIRLSPYQSTSQADIEDKRHPVLRVLWKPDIYGLGLMAMDDAQHHVQKFADEAHSPVSG
PLLKMGAMLDLLAHKNPRLRILEIGNDVQDITLAVLGLLSAQGSFKRLSAYSTASVSDDGTILGGLLNLETGERC
SSPTELDHEYDLILLPAMNEHIDRAVDTFGGLMADDASILALCPGLTSNSFASRGLDCLPVRLSEDGTTLIVARK
PQELQQVSLQRHKFLIVEREKTALGSALADTLKPIQGQWVMRVRLNELTPAHVSSGTTIFNLCEIKSPLLSVISD
DEMARVKVMTDNATLLVWVTNGNIMHGDRPDFALVSGLARALMLEQPSLKLYTYDIDEPETQIHMTAKRLVSLLT
QPGKKPDLEFAQRKGVVHVSRFTPDDSINTLFRNKQGLETTESSLHDAKDVRLAIEQAGQLDTIYFQQLKAPQTI
GPTDLRIRVASVGLNAKDYYVLVGRVDTPDATCQLECAGTVEQVGSLVTDFAPGDRVVAMAPSHFQTYQTLPQWA
CHKLTDAESFDISATLPIVYATAIYALHYRAHIQAGETVLIHSGAGGVGIAAIQLALHAGAEVFTTVSSDEKKKF
LVDKLGVKASNIFSSRDTSFLEGIFSATSGRGVDVILNSLTGDQLHATWRCCAAFGRFVEIGKMDLTTAGRLEMD
QFLQSTTFTAFDLSHLYHTDSEQLHSLWNDLLSQAMKLYRQGTITAFEPLNIFDIGETEQAFRYFSSRSRIGKVA
INLERAESTIPIQPLRHTTQFDSEKSYVMVGCLGGLGRTLSRWMVNRGARKFTFLGRSGIDKAAARHLVQDLEAS
GARCEVVRGDVCEASDVEAVITAAAAMGEIGGVVQAAMGLNEAIFSVMPNEYWHTGIDPKVQGSWNLYNSLQMHG
RGSHLDFFLMTSSVSGSVGTATESNYCAANHFLDQFSRFLRNQGYPAVAVGLGMISEVGYLHDNPEIEALLLRKG
IQAIDADELLQLIDLALSSSATMGISHAHDELAASHLLTGLEAFGLKELRKRGFEGSHPALDDPRANLLASALDG
GSDESSQAQNGSLPAEVTTLMQSGHTLDEAVLDHIRRRFGNLVLLKYEVVDVKKPLLQYGMDSMIGAEFRTWFYQ
SLTTDVPLVMLLGSSCTLESLRDLAMTSLEVGK*
Coding >Pro_DTO377G3_2|g5789.t1
ATGTCGCCTATTTTACTAGATTCATCACCTGCGGATGAAGGCCTTGGTGAGGCCATTGCCATCTGCGGAATTGCC
TGTCGCCTACCAGGGGAAGTTTCAAGCCCTCGTGAATTTTGGGATCTGATTTCCAATGGTAGATCGGCCCAATGC
AAGGTCCCCAAATCGCGTTTCAATGTCGACGGCTTCTATCACCCCCAGGGCATGGATCGCCCCGGAAGTATGATC
ACAGAAGGCGGTTATTTTCTTGATGATGACGTGCGAGAGTTTGAGAACAGTTTCTTTGGGATCAACAACCTCGAA
GCGAAGTATATGGACCCTCAACAACGAAAGATGCTTGAAGTTGTATACGAATGCATGGAAAATGCAGGAATACCT
CTGGATCAAGCATCTGGGTCAAATACAGGATGTTATGTGGGAAATTTCACTGTTGACTACATGGTGATGCAGCTG
AAAGACCCTGACTATCTGAGCCGTTACTCTGGAACGGGTCTAGGCACTACAATCTTGGCAAACCGCATCAGCCAT
GTCTTCAATCTTCTAGGACCTAGTCTTCTTCTTGACACAGCCTGCTCCTCATCACTCTACTGTCTTCACATGGCA
TGTACAGCCCTGCAGAATCGCGAATGTGACGCCGCCATTGTTGCCGGCGCGAACCTGATTCAGTCCGCCGAGCAA
CATATTGCTACAATGAAAGCTGGGGTCCTCTCCGGAACATCAGCGTGCCACACATTTGACACTTCTGCCGACGGC
TATGGTCGTGCGGATGGCATTGGGGCCTTGTATGTCAAGAGGCTCGAAGATGCCCTGCGAGATGGTGACCCAATC
CGGAGTCTGATACGTGGGTCAGCGGTCAACGCGAATGGCAAGACATCTGGAATCAGTTTACCCAGCGCCGATGGT
CAGGAGGCGGTAATCCAAAAGGCCATGGCCAAGGGTGGAATCGTTCCGGACGACATTACGTTTGTCGAGTGTCAT
GGCACCGGGACCAAAGTCGGCGATGCCATCGAGGTTGAGGCATTATCGCGGGTGTTTCAACGCACGCCAAATAAC
CCCCTCATGATCGGGTCGGTGAAAAGTAATGTCGGACATTCTGAAGCAGCGAGCGGAATTTCAAGCGTGATCAAG
TCTACCCTTGCCCTTGAACGCGGCCAAATTCCACCCACTCATGGCTTAAAAAACATCAATCCAAAGTTGAAGGTT
GAGGACAGGAATATCAAAATTCCAACTGAGTTGACGAATTGGCCAAACCACTCGTCTCGAGTGCGGCGTGTTGGT
ATTAACTCTTTTGGTTACGGCGGTGCGAACTGTCATGTTATCCTAGAGCAGCCTACCAAGACTTTGAGTTCATCT
CGGCAGCTCAGACAACTGCCCATCACCCAGTCCACAGTGATCCTACCTCTATCCGCTGCCTCAACCGCCTCCCTC
GAAGCCCGCGTAGCGGACTTTGCACGATATGAATTTGGTGACACAGATATTGCAGACCTTGCGTATACATTGGGC
TCCAGGCGAACTCACTTTGCCGAGAGAGGGTTTTTACTTGCTCCGCGGTCACAGGAAAGCTCTCATAGTTTCCAG
ACACGCACCTGGGTAACATCAGCCAGCCCAGTCACAGGTGTTGCATCTACTCCATTTGCGTTTGTTTTCACCGGA
CAGGGGTCTCAGTGGCCCGGCATGTGTCGTGAGCTCCTCTCGGAATTTTCTCTTTTCCGGGATACCATCACGGAG
ATGGACTCAGTCCTCAAGAGCCTCCCAGGGCCCCCCAGTTGGTCACTGATGGAGGCGATCTTGGATGTTGATAAC
CCAAGCCTCATCCATCTACCACAGCGATCTCAACCATGCTGTACTGCGATACAAGTTGCCCTCATTCGACTTCTG
TCTTCTTGGGAAATTGCCCCTACGATGACAGTCGGCCACTCTTCGGGTGAAATCGCAGCTGCCTTCGCCGCAGGT
CATGTCTCTGCAGCCGAGGCAATCGTAATTGCCTACTATCGTGGATACTGCGTCTCAAAATCTACTCGTGTCGGT
GCTATGATGGCTATCGGCTTGTCTGAAAGCTCCACCACGGACGAAATTGCGAAAGCAGGACTGGATGACCAGATC
CGAGTGGCTTGCGTCAACTCTCCGGAGGGGGTCACCGTCTCAGGCGATGAGAATGCATTGGACATCTTCTTGGCG
ACTTTGCAACAGAGGAATATTTTCGCGCGCAAGCTGAAGACAGGCGGGCAGGCGTATCACTCCCACCACATGGTA
TCCATTGGAGAAGAGTACCAGGCCCTGTTGGAACGGGCCCTCCCTAGTTTGGGTCCCTCGATTCGACAGCCCCAG
GGTGCCTCTGTGATGTCTTCGGTGACTGGTGAGCTCAAGTCATCTGGATTCACAGCAAGTTACTGGAGAAGCAAC
CTAGAAAGCCAGGTGCGGTTTGCTCATGCGATTGAACGCATTCATGAACTCACGGAGCACTGTTTTATCGAGCTT
GGCCCTCACTCTTCACTGGAACTGCCGATCAAGCAAACCTTGGCAAAAGCCGGCGCAGAACTCAAATATGCTGCC
CCAATCAAGCGTAATGTGGACTCGATGGAAAGCATCCTGAGCTTTGCTGGAAACCTGTGGCTCAAAGGGTATGAG
ATCAATTGGTCAAAGGTCAATGGCCTCCAGACAGGGTTGAAGTCTGTGCGCTCTATGTACCGCGTGGTCACAGAT
CTTCCACCGTATCGCTTCAACTACGAGAACATCCTCTGGAACGAATGCCGCGCCAGTGTTGAATACAGGCAGCGC
AAGTATCCGCATCATGAACTCCTGGGTAGCCTACTCACCGGTGGAAATGCCCGCGACAAGATCTTCCGCAATATC
CTCAAGGTGGATGATGTCTCCTGGCTTAAGGACCATAAGCTTGGTGATACGGTCGTTTTCCCTGGTGCAGGGTAT
TTGGCGATGGCGATGGAGGCTGTTATGCAGGCCACCGACGCGGCGCGCACGGACCCTACATTTCAATTCTCCAAC
GTCAACATCACGAACGCGTTGACCTTGAACACAGAATTCTCGACCAGCGCGGAGATCTTCACTTCTCTGCACAAG
TCTGTCATTACCAATGCAGCCACATCAGCCACCTGGTGGGACTTTGCTATATCAAGCTACCACAATGGATCTGCG
GTACAGCATGCATCTGGATCGATCGCTATTCACCCACGCAACGCGGCTCTGCAGTCAAAATATAAGCCACCAAGC
GGAGCGCTTGAATCCACAGCCAAGCGGACTTGGTACGAAAAATTCATCAGGCAGGGGTTGAACTATGGCCCAACC
TTCCAAACCATCTCCGAATTTTATACCCCGCGTATGAAATCGGAGTCGTTCGCTAGTGCTACAGCGCCTCTATTG
AAGACAAGTGGCGATTCCATTTCGGTATATCCAGTGCACCCAATCGCTTTGGACGGCATGATCCAACTAGCTGTG
GTTGCAGCCACCAATGGCAAACCTAAGGAGTTACGTGCCCAGATACCCACGAGGCTGCCATCGGCAATCGTCCAC
ACTTCTACTTCCTCCAATCAGACTTGCCAAATGCATGCAGTCGTCAAACGGATTGGATTCGGATACACTCATGCT
GGTATAGAAATGATTGACAGCGATGGACAAATTGTGGCTCAATTCGATGATATTCGACTCTCCCCGTACCAATCC
ACCAGTCAAGCAGACATAGAAGATAAGCGCCATCCAGTTCTTCGGGTACTTTGGAAGCCTGACATTTATGGACTG
GGGCTCATGGCCATGGATGATGCGCAGCACCATGTCCAGAAGTTTGCTGATGAGGCCCATTCACCGGTGTCCGGC
CCGCTCCTCAAGATGGGCGCTATGCTGGACCTTTTGGCGCACAAAAATCCCCGCCTCCGTATTTTGGAAATTGGA
AATGATGTGCAAGACATCACCCTGGCTGTATTGGGACTTCTATCCGCACAGGGGAGCTTCAAGCGCCTGTCCGCA
TATAGCACAGCATCAGTTTCTGATGATGGCACTATCTTGGGAGGTCTCTTAAACCTTGAGACTGGAGAGCGCTGC
TCCAGTCCCACTGAACTGGACCATGAGTATGACCTCATCCTACTTCCGGCGATGAACGAACATATCGACCGGGCC
GTGGATACCTTTGGCGGCTTGATGGCCGACGACGCATCCATTTTGGCCTTATGCCCCGGATTGACAAGCAATTCA
TTTGCCTCGCGTGGTCTCGATTGTCTTCCCGTCCGCCTTTCCGAGGATGGTACAACACTTATCGTTGCGCGCAAG
CCGCAGGAATTGCAACAAGTTTCACTGCAAAGGCACAAATTCCTCATCGTTGAGCGTGAGAAAACTGCGCTCGGA
TCTGCACTGGCGGATACCCTGAAACCCATCCAAGGACAATGGGTGATGCGCGTCCGGCTAAATGAGCTCACACCC
GCACATGTCTCGAGCGGGACAACAATTTTCAACCTCTGTGAGATAAAGTCTCCTCTTCTATCCGTCATCTCTGAC
GATGAGATGGCCCGCGTCAAGGTCATGACAGACAACGCAACATTATTGGTGTGGGTTACCAATGGTAATATTATG
CATGGTGACAGGCCGGACTTTGCTCTTGTATCTGGCCTGGCCCGAGCATTGATGCTAGAACAACCCTCGCTTAAG
CTCTACACCTATGATATTGACGAGCCTGAAACTCAAATCCATATGACTGCGAAGCGTCTGGTATCTCTTCTCACC
CAGCCTGGTAAGAAGCCAGACCTAGAATTTGCGCAGCGCAAGGGGGTGGTCCACGTCTCGCGGTTCACACCCGAT
GACAGCATTAATACCCTCTTCCGCAACAAGCAGGGACTTGAGACGACCGAGTCTAGCTTACACGATGCCAAAGAC
GTGAGACTCGCCATCGAGCAAGCTGGGCAGCTGGACACTATTTATTTCCAGCAGCTGAAAGCTCCACAAACGATT
GGCCCGACCGATTTGCGCATCCGGGTCGCGTCGGTCGGTCTCAATGCGAAAGACTATTATGTCTTGGTTGGACGA
GTCGACACGCCCGACGCCACCTGTCAGTTGGAATGCGCTGGCACAGTCGAACAAGTAGGGTCTCTTGTGACAGAT
TTCGCTCCCGGAGATCGTGTCGTTGCCATGGCACCAAGCCATTTCCAAACATATCAAACCCTTCCTCAGTGGGCA
TGCCACAAGCTTACCGATGCGGAGAGCTTTGACATTAGCGCTACGTTACCTATAGTCTACGCCACCGCCATCTAT
GCCTTGCACTACCGGGCCCATATCCAGGCTGGGGAGACGGTCTTGATTCATTCCGGAGCCGGCGGAGTTGGCATC
GCGGCAATCCAATTAGCTCTACATGCAGGAGCGGAGGTGTTCACCACTGTCTCTTCAGATGAGAAGAAAAAGTTC
TTGGTGGATAAACTTGGCGTCAAAGCATCCAACATCTTCAGCTCTCGCGATACTTCTTTCCTCGAGGGTATCTTC
AGTGCTACGTCTGGGCGCGGCGTAGACGTCATTCTCAACTCTCTGACAGGCGATCAGCTACACGCGACGTGGAGG
TGCTGTGCAGCGTTTGGTCGTTTTGTGGAGATTGGCAAGATGGACCTTACCACCGCTGGCCGTCTAGAAATGGAC
CAATTCCTACAAAGTACCACTTTCACAGCCTTCGATCTCAGCCATCTCTACCACACCGATAGTGAGCAGCTTCAC
TCTCTATGGAATGACCTTCTTTCCCAGGCCATGAAACTCTACCGGCAGGGAACCATCACCGCGTTCGAGCCGCTG
AATATTTTTGATATCGGTGAGACTGAGCAGGCATTCCGTTACTTCTCATCGCGCAGCAGAATCGGCAAGGTGGCC
ATTAATCTTGAACGGGCTGAGTCCACCATCCCAATCCAACCCCTGAGGCACACCACGCAATTTGACAGTGAGAAG
AGCTATGTGATGGTAGGCTGCTTGGGCGGTCTGGGGCGCACTCTTTCGCGTTGGATGGTCAACCGAGGTGCCCGG
AAATTTACCTTCCTAGGTCGATCCGGTATTGACAAGGCAGCTGCACGCCACCTGGTCCAAGACCTCGAAGCATCA
GGTGCCAGATGCGAGGTAGTCAGAGGTGACGTTTGCGAGGCGTCTGATGTCGAAGCCGTTATCACTGCGGCTGCC
GCCATGGGTGAGATTGGCGGAGTTGTGCAGGCGGCCATGGGTCTGAATGAAGCAATTTTCTCTGTCATGCCCAAC
GAATACTGGCATACTGGCATCGACCCCAAAGTACAAGGATCTTGGAATTTGTACAACAGCCTGCAGATGCACGGA
CGGGGCTCTCATCTTGATTTCTTCCTGATGACTTCCTCCGTCTCTGGCAGCGTCGGTACTGCGACCGAGTCTAAC
TACTGTGCCGCAAACCATTTCCTTGACCAGTTCTCTCGCTTCCTGCGCAACCAAGGATATCCGGCCGTTGCGGTT
GGCTTGGGTATGATCTCAGAAGTCGGCTATCTACATGATAATCCCGAAATTGAGGCCCTCCTTTTACGCAAAGGG
ATTCAGGCCATTGATGCCGACGAGCTCCTCCAGCTCATTGATCTTGCCTTGTCATCCAGCGCTACAATGGGAATA
TCGCACGCACACGATGAATTAGCCGCTTCCCATCTTCTGACGGGTCTAGAAGCCTTCGGACTAAAGGAATTGCGC
AAGAGAGGCTTCGAAGGGTCCCATCCAGCTTTGGACGATCCACGCGCCAATCTTTTAGCCAGCGCCTTGGACGGT
GGCTCGGATGAGTCATCGCAAGCGCAGAACGGAAGCCTACCTGCTGAGGTTACGACCCTGATGCAATCAGGTCAC
ACCCTCGACGAGGCTGTGCTGGATCACATCCGCCGGCGATTTGGCAACCTCGTCCTTTTGAAGTACGAGGTTGTG
GATGTCAAGAAGCCTTTGCTGCAATACGGCATGGACAGTATGATTGGGGCTGAATTCCGAACATGGTTCTACCAG
AGCTTGACAACCGATGTGCCGTTGGTCATGTTGCTCGGCTCGTCCTGCACGCTCGAGTCACTTAGGGACCTGGCG
ATGACCAGCTTGGAAGTGGGAAAATAA
Transcript >Pro_DTO377G3_2|g5789.t1
ATGTCGCCTATTTTACTAGATTCATCACCTGCGGATGAAGGCCTTGGTGAGGCCATTGCCATCTGCGGAATTGCC
TGTCGCCTACCAGGGGAAGTTTCAAGCCCTCGTGAATTTTGGGATCTGATTTCCAATGGTAGATCGGCCCAATGC
AAGGTCCCCAAATCGCGTTTCAATGTCGACGGCTTCTATCACCCCCAGGGCATGGATCGCCCCGGAAGTATGATC
ACAGAAGGCGGTTATTTTCTTGATGATGACGTGCGAGAGTTTGAGAACAGTTTCTTTGGGATCAACAACCTCGAA
GCGAAGTATATGGACCCTCAACAACGAAAGATGCTTGAAGTTGTATACGAATGCATGGAAAATGCAGGAATACCT
CTGGATCAAGCATCTGGGTCAAATACAGGATGTTATGTGGGAAATTTCACTGTTGACTACATGGTGATGCAGCTG
AAAGACCCTGACTATCTGAGCCGTTACTCTGGAACGGGTCTAGGCACTACAATCTTGGCAAACCGCATCAGCCAT
GTCTTCAATCTTCTAGGACCTAGTCTTCTTCTTGACACAGCCTGCTCCTCATCACTCTACTGTCTTCACATGGCA
TGTACAGCCCTGCAGAATCGCGAATGTGACGCCGCCATTGTTGCCGGCGCGAACCTGATTCAGTCCGCCGAGCAA
CATATTGCTACAATGAAAGCTGGGGTCCTCTCCGGAACATCAGCGTGCCACACATTTGACACTTCTGCCGACGGC
TATGGTCGTGCGGATGGCATTGGGGCCTTGTATGTCAAGAGGCTCGAAGATGCCCTGCGAGATGGTGACCCAATC
CGGAGTCTGATACGTGGGTCAGCGGTCAACGCGAATGGCAAGACATCTGGAATCAGTTTACCCAGCGCCGATGGT
CAGGAGGCGGTAATCCAAAAGGCCATGGCCAAGGGTGGAATCGTTCCGGACGACATTACGTTTGTCGAGTGTCAT
GGCACCGGGACCAAAGTCGGCGATGCCATCGAGGTTGAGGCATTATCGCGGGTGTTTCAACGCACGCCAAATAAC
CCCCTCATGATCGGGTCGGTGAAAAGTAATGTCGGACATTCTGAAGCAGCGAGCGGAATTTCAAGCGTGATCAAG
TCTACCCTTGCCCTTGAACGCGGCCAAATTCCACCCACTCATGGCTTAAAAAACATCAATCCAAAGTTGAAGGTT
GAGGACAGGAATATCAAAATTCCAACTGAGTTGACGAATTGGCCAAACCACTCGTCTCGAGTGCGGCGTGTTGGT
ATTAACTCTTTTGGTTACGGCGGTGCGAACTGTCATGTTATCCTAGAGCAGCCTACCAAGACTTTGAGTTCATCT
CGGCAGCTCAGACAACTGCCCATCACCCAGTCCACAGTGATCCTACCTCTATCCGCTGCCTCAACCGCCTCCCTC
GAAGCCCGCGTAGCGGACTTTGCACGATATGAATTTGGTGACACAGATATTGCAGACCTTGCGTATACATTGGGC
TCCAGGCGAACTCACTTTGCCGAGAGAGGGTTTTTACTTGCTCCGCGGTCACAGGAAAGCTCTCATAGTTTCCAG
ACACGCACCTGGGTAACATCAGCCAGCCCAGTCACAGGTGTTGCATCTACTCCATTTGCGTTTGTTTTCACCGGA
CAGGGGTCTCAGTGGCCCGGCATGTGTCGTGAGCTCCTCTCGGAATTTTCTCTTTTCCGGGATACCATCACGGAG
ATGGACTCAGTCCTCAAGAGCCTCCCAGGGCCCCCCAGTTGGTCACTGATGGAGGCGATCTTGGATGTTGATAAC
CCAAGCCTCATCCATCTACCACAGCGATCTCAACCATGCTGTACTGCGATACAAGTTGCCCTCATTCGACTTCTG
TCTTCTTGGGAAATTGCCCCTACGATGACAGTCGGCCACTCTTCGGGTGAAATCGCAGCTGCCTTCGCCGCAGGT
CATGTCTCTGCAGCCGAGGCAATCGTAATTGCCTACTATCGTGGATACTGCGTCTCAAAATCTACTCGTGTCGGT
GCTATGATGGCTATCGGCTTGTCTGAAAGCTCCACCACGGACGAAATTGCGAAAGCAGGACTGGATGACCAGATC
CGAGTGGCTTGCGTCAACTCTCCGGAGGGGGTCACCGTCTCAGGCGATGAGAATGCATTGGACATCTTCTTGGCG
ACTTTGCAACAGAGGAATATTTTCGCGCGCAAGCTGAAGACAGGCGGGCAGGCGTATCACTCCCACCACATGGTA
TCCATTGGAGAAGAGTACCAGGCCCTGTTGGAACGGGCCCTCCCTAGTTTGGGTCCCTCGATTCGACAGCCCCAG
GGTGCCTCTGTGATGTCTTCGGTGACTGGTGAGCTCAAGTCATCTGGATTCACAGCAAGTTACTGGAGAAGCAAC
CTAGAAAGCCAGGTGCGGTTTGCTCATGCGATTGAACGCATTCATGAACTCACGGAGCACTGTTTTATCGAGCTT
GGCCCTCACTCTTCACTGGAACTGCCGATCAAGCAAACCTTGGCAAAAGCCGGCGCAGAACTCAAATATGCTGCC
CCAATCAAGCGTAATGTGGACTCGATGGAAAGCATCCTGAGCTTTGCTGGAAACCTGTGGCTCAAAGGGTATGAG
ATCAATTGGTCAAAGGTCAATGGCCTCCAGACAGGGTTGAAGTCTGTGCGCTCTATGTACCGCGTGGTCACAGAT
CTTCCACCGTATCGCTTCAACTACGAGAACATCCTCTGGAACGAATGCCGCGCCAGTGTTGAATACAGGCAGCGC
AAGTATCCGCATCATGAACTCCTGGGTAGCCTACTCACCGGTGGAAATGCCCGCGACAAGATCTTCCGCAATATC
CTCAAGGTGGATGATGTCTCCTGGCTTAAGGACCATAAGCTTGGTGATACGGTCGTTTTCCCTGGTGCAGGGTAT
TTGGCGATGGCGATGGAGGCTGTTATGCAGGCCACCGACGCGGCGCGCACGGACCCTACATTTCAATTCTCCAAC
GTCAACATCACGAACGCGTTGACCTTGAACACAGAATTCTCGACCAGCGCGGAGATCTTCACTTCTCTGCACAAG
TCTGTCATTACCAATGCAGCCACATCAGCCACCTGGTGGGACTTTGCTATATCAAGCTACCACAATGGATCTGCG
GTACAGCATGCATCTGGATCGATCGCTATTCACCCACGCAACGCGGCTCTGCAGTCAAAATATAAGCCACCAAGC
GGAGCGCTTGAATCCACAGCCAAGCGGACTTGGTACGAAAAATTCATCAGGCAGGGGTTGAACTATGGCCCAACC
TTCCAAACCATCTCCGAATTTTATACCCCGCGTATGAAATCGGAGTCGTTCGCTAGTGCTACAGCGCCTCTATTG
AAGACAAGTGGCGATTCCATTTCGGTATATCCAGTGCACCCAATCGCTTTGGACGGCATGATCCAACTAGCTGTG
GTTGCAGCCACCAATGGCAAACCTAAGGAGTTACGTGCCCAGATACCCACGAGGCTGCCATCGGCAATCGTCCAC
ACTTCTACTTCCTCCAATCAGACTTGCCAAATGCATGCAGTCGTCAAACGGATTGGATTCGGATACACTCATGCT
GGTATAGAAATGATTGACAGCGATGGACAAATTGTGGCTCAATTCGATGATATTCGACTCTCCCCGTACCAATCC
ACCAGTCAAGCAGACATAGAAGATAAGCGCCATCCAGTTCTTCGGGTACTTTGGAAGCCTGACATTTATGGACTG
GGGCTCATGGCCATGGATGATGCGCAGCACCATGTCCAGAAGTTTGCTGATGAGGCCCATTCACCGGTGTCCGGC
CCGCTCCTCAAGATGGGCGCTATGCTGGACCTTTTGGCGCACAAAAATCCCCGCCTCCGTATTTTGGAAATTGGA
AATGATGTGCAAGACATCACCCTGGCTGTATTGGGACTTCTATCCGCACAGGGGAGCTTCAAGCGCCTGTCCGCA
TATAGCACAGCATCAGTTTCTGATGATGGCACTATCTTGGGAGGTCTCTTAAACCTTGAGACTGGAGAGCGCTGC
TCCAGTCCCACTGAACTGGACCATGAGTATGACCTCATCCTACTTCCGGCGATGAACGAACATATCGACCGGGCC
GTGGATACCTTTGGCGGCTTGATGGCCGACGACGCATCCATTTTGGCCTTATGCCCCGGATTGACAAGCAATTCA
TTTGCCTCGCGTGGTCTCGATTGTCTTCCCGTCCGCCTTTCCGAGGATGGTACAACACTTATCGTTGCGCGCAAG
CCGCAGGAATTGCAACAAGTTTCACTGCAAAGGCACAAATTCCTCATCGTTGAGCGTGAGAAAACTGCGCTCGGA
TCTGCACTGGCGGATACCCTGAAACCCATCCAAGGACAATGGGTGATGCGCGTCCGGCTAAATGAGCTCACACCC
GCACATGTCTCGAGCGGGACAACAATTTTCAACCTCTGTGAGATAAAGTCTCCTCTTCTATCCGTCATCTCTGAC
GATGAGATGGCCCGCGTCAAGGTCATGACAGACAACGCAACATTATTGGTGTGGGTTACCAATGGTAATATTATG
CATGGTGACAGGCCGGACTTTGCTCTTGTATCTGGCCTGGCCCGAGCATTGATGCTAGAACAACCCTCGCTTAAG
CTCTACACCTATGATATTGACGAGCCTGAAACTCAAATCCATATGACTGCGAAGCGTCTGGTATCTCTTCTCACC
CAGCCTGGTAAGAAGCCAGACCTAGAATTTGCGCAGCGCAAGGGGGTGGTCCACGTCTCGCGGTTCACACCCGAT
GACAGCATTAATACCCTCTTCCGCAACAAGCAGGGACTTGAGACGACCGAGTCTAGCTTACACGATGCCAAAGAC
GTGAGACTCGCCATCGAGCAAGCTGGGCAGCTGGACACTATTTATTTCCAGCAGCTGAAAGCTCCACAAACGATT
GGCCCGACCGATTTGCGCATCCGGGTCGCGTCGGTCGGTCTCAATGCGAAAGACTATTATGTCTTGGTTGGACGA
GTCGACACGCCCGACGCCACCTGTCAGTTGGAATGCGCTGGCACAGTCGAACAAGTAGGGTCTCTTGTGACAGAT
TTCGCTCCCGGAGATCGTGTCGTTGCCATGGCACCAAGCCATTTCCAAACATATCAAACCCTTCCTCAGTGGGCA
TGCCACAAGCTTACCGATGCGGAGAGCTTTGACATTAGCGCTACGTTACCTATAGTCTACGCCACCGCCATCTAT
GCCTTGCACTACCGGGCCCATATCCAGGCTGGGGAGACGGTCTTGATTCATTCCGGAGCCGGCGGAGTTGGCATC
GCGGCAATCCAATTAGCTCTACATGCAGGAGCGGAGGTGTTCACCACTGTCTCTTCAGATGAGAAGAAAAAGTTC
TTGGTGGATAAACTTGGCGTCAAAGCATCCAACATCTTCAGCTCTCGCGATACTTCTTTCCTCGAGGGTATCTTC
AGTGCTACGTCTGGGCGCGGCGTAGACGTCATTCTCAACTCTCTGACAGGCGATCAGCTACACGCGACGTGGAGG
TGCTGTGCAGCGTTTGGTCGTTTTGTGGAGATTGGCAAGATGGACCTTACCACCGCTGGCCGTCTAGAAATGGAC
CAATTCCTACAAAGTACCACTTTCACAGCCTTCGATCTCAGCCATCTCTACCACACCGATAGTGAGCAGCTTCAC
TCTCTATGGAATGACCTTCTTTCCCAGGCCATGAAACTCTACCGGCAGGGAACCATCACCGCGTTCGAGCCGCTG
AATATTTTTGATATCGGTGAGACTGAGCAGGCATTCCGTTACTTCTCATCGCGCAGCAGAATCGGCAAGGTGGCC
ATTAATCTTGAACGGGCTGAGTCCACCATCCCAATCCAACCCCTGAGGCACACCACGCAATTTGACAGTGAGAAG
AGCTATGTGATGGTAGGCTGCTTGGGCGGTCTGGGGCGCACTCTTTCGCGTTGGATGGTCAACCGAGGTGCCCGG
AAATTTACCTTCCTAGGTCGATCCGGTATTGACAAGGCAGCTGCACGCCACCTGGTCCAAGACCTCGAAGCATCA
GGTGCCAGATGCGAGGTAGTCAGAGGTGACGTTTGCGAGGCGTCTGATGTCGAAGCCGTTATCACTGCGGCTGCC
GCCATGGGTGAGATTGGCGGAGTTGTGCAGGCGGCCATGGGTCTGAATGAAGCAATTTTCTCTGTCATGCCCAAC
GAATACTGGCATACTGGCATCGACCCCAAAGTACAAGGATCTTGGAATTTGTACAACAGCCTGCAGATGCACGGA
CGGGGCTCTCATCTTGATTTCTTCCTGATGACTTCCTCCGTCTCTGGCAGCGTCGGTACTGCGACCGAGTCTAAC
TACTGTGCCGCAAACCATTTCCTTGACCAGTTCTCTCGCTTCCTGCGCAACCAAGGATATCCGGCCGTTGCGGTT
GGCTTGGGTATGATCTCAGAAGTCGGCTATCTACATGATAATCCCGAAATTGAGGCCCTCCTTTTACGCAAAGGG
ATTCAGGCCATTGATGCCGACGAGCTCCTCCAGCTCATTGATCTTGCCTTGTCATCCAGCGCTACAATGGGAATA
TCGCACGCACACGATGAATTAGCCGCTTCCCATCTTCTGACGGGTCTAGAAGCCTTCGGACTAAAGGAATTGCGC
AAGAGAGGCTTCGAAGGGTCCCATCCAGCTTTGGACGATCCACGCGCCAATCTTTTAGCCAGCGCCTTGGACGGT
GGCTCGGATGAGTCATCGCAAGCGCAGAACGGAAGCCTACCTGCTGAGGTTACGACCCTGATGCAATCAGGTCAC
ACCCTCGACGAGGCTGTGCTGGATCACATCCGCCGGCGATTTGGCAACCTCGTCCTTTTGAAGTACGAGGTTGTG
GATGTCAAGAAGCCTTTGCTGCAATACGGCATGGACAGTATGATTGGGGCTGAATTCCGAACATGGTTCTACCAG
AGCTTGACAACCGATGTGCCGTTGGTCATGTTGCTCGGCTCGTCCTGCACGCTCGAGTCACTTAGGGACCTGGCG
ATGACCAGCTTGGAAGTGGGAAAATAA
Gene >Pro_DTO377G3_2|g5789.t1
ATGTCGCCTATTTTACTAGATTCATCACCTGCGGATGAAGGCCTTGGTGAGGCCATTGCCATCTGCGGAATTGGT
AAGGCATGCTTCTTGATTGTCTTTGTGAATTGTAATAATATTTATCTCCCATCAGCCTGTCGCCTACCAGGGGAA
GTTTCAAGCCCTCGTGAATTTTGGGATCTGATTTCCAATGGTAGATCGGCCCAATGCAAGGTCCCCAAATCGCGT
TTCAATGTCGACGGCTTCTATCACCCCCAGGGCATGGATCGCCCCGGAAGTATGATCACAGAAGGCGGTTATTTT
CTTGATGATGACGTGCGAGAGTTTGAGAACAGTTTCTTTGGGATCAACAACCTCGAAGCGAAGTATATGGACCCT
CAACAACGAAAGATGCTTGAAGTTGTATACGAATGCATGGAAAATGCAGGAATACCTCTGGATCAAGCATCTGGG
TCAAATACAGGATGTTATGTGGGAAATTTCACTGTTGACTACATGGTGATGCAGCTGAAAGACCCTGACTAGTAA
GTACATATTGTCCTTTTCATGGGTCCGTTGTTAGGTCTCATAGCTAACTAGTGTAGTCTGAGCCGTTACTCTGGA
ACGGGTCTAGGCACTACAATCTTGGCAAACCGCATCAGCCATGTCTTCAATCTTCTAGGACCTAGGTAAGTCGTA
AATTGCAACATATCCACTGGAATTTATGATTTCTCACCTTTGGTCGCTTCTGTTCAGTCTTCTTCTTGACACAGC
CTGCTCCTCATCACTCTACTGTCTTCACATGGCATGTACAGCCCTGCAGAATCGCGAATGTGACGCCGCCATTGT
TGCCGGCGCGAACCTGATTCAGTCCGCCGAGCAACATATTGCTACAATGAAAGCTGGGGTCCTCTCCGGAACATC
AGCGTGCCACACATTTGACACTTCTGCCGACGGCTATGGTCGTGCGGATGGCATTGGGGCCTTGTATGTCAAGAG
GCTCGAAGATGCCCTGCGAGATGGTGACCCAATCCGGAGTCTGATACGTGGGTCAGCGGTCAACGCGTAAGTGAA
GCTTTTTTTTTCTCCCCAACTCCTGGCTTTGTGCTGAAATGCGATTGTATCCAGGAATGGCAAGACATCTGGAAT
CAGTTTACCCAGCGCCGATGGTCAGGAGGCGGTAATCCAAAAGGCCATGGCCAAGGGTGGAATCGTTCCGGACGA
CATTACGTTTGTCGAGTGTCATGGCACCGGGACCAAAGTCGGCGATGCCATCGAGGTTGAGGCATTATCGCGGGT
GTTTCAACGCACGCCAAATAACCCCCTCATGATCGGGTCGGTGAAAAGTAATGTCGGACATTCTGAAGCAGCGAG
CGGAATTTCAAGCGTGATCAAGTCTACCCTTGCCCTTGAACGCGGCCAAATTCCACCCACTCATGGCTTAAAAAA
CATCAATCCAAAGTTGAAGGTTGAGGACAGGAATATCAAAATTCCAACTGAGTTGACGAATTGGCCAAACCACTC
GTCTCGAGTGCGGCGTGTTGGTTAGTACGGCGTGTTCGACAGACAAGAAGACCAATCAGCTAATTCATCACTCAA
GGTATTAACTCTTTTGGTTACGGCGGTGCGAACTGTCATGTTATCCTAGAGCAGCCTACCAAGACTTTGAGTTCA
TCTCGGCAGCTCAGACAACTGCCCATCACCCAGTCCACAGTGATCCTACCTCTATCCGCTGCCTCAACCGCCTCC
CTCGAAGCCCGCGTAGCGGACTTTGCACGATATGAATTTGGTGACACAGATATTGCAGACCTTGCGTATACATTG
GGCTCCAGGCGAACTCACTTTGCCGAGAGAGGGTTTTTACTTGCTCCGCGGTCACAGGAAAGCTCTCATAGTTTC
CAGACACGCACCTGGGTAACATCAGCCAGCCCAGTCACAGGTGTTGCATCTACTCCATTTGCGTTTGTTTTCACC
GGACAGGGGTCTCAGTGGCCCGGCATGTGTCGTGAGCTCCTCTCGGAATTTTCTCTTTTCCGGGATACCATCACG
GAGATGGACTCAGTCCTCAAGAGCCTCCCAGGGCCCCCCAGTTGGTCACTGATGGAGGCGATCTTGGATGTTGAT
AACCCAAGCCTCATCCATCTACCACAGCGATCTCAACCATGCTGTACTGCGATACAAGTTGCCCTCATTCGACTT
CTGTCTTCTTGGGAAATTGCCCCTACGATGACAGTCGGCCACTCTTCGGGTGAAATCGCAGCTGCCTTCGCCGCA
GGTCATGTCTCTGCAGCCGAGGCAATCGTAATTGCCTACTATCGTGGATACTGCGTCTCAAAATCTACTCGTGTC
GGTGCTATGATGGCTATCGGCTTGTCTGAAAGCTCCACCACGGACGAAATTGCGAAAGCAGGACTGGATGACCAG
ATCCGAGTGGCTTGCGTCAACTCTCCGGAGGGGGTCACCGTCTCAGGCGATGAGAATGCATTGGACATCTTCTTG
GCGACTTTGCAACAGAGGAATATTTTCGCGCGCAAGCTGAAGACAGGCGGGCAGGCGTATCACTCCCACCACATG
GTATCCATTGGAGAAGAGTACCAGGCCCTGTTGGAACGGGCCCTCCCTAGTTTGGGTCCCTCGATTCGACAGCCC
CAGGGTGCCTCTGTGATGTCTTCGGTGACTGGTGAGCTCAAGTCATCTGGATTCACAGCAAGTTACTGGAGAAGC
AACCTAGAAAGCCAGGTGCGGTTTGCTCATGCGATTGAACGCATTCATGAACTCACGGAGCACTGTTTTATCGAG
CTTGGCCCTCACTCTTCACTGGAACTGCCGATCAAGCAAACCTTGGCAAAAGCCGGCGCAGAACTCAAATATGCT
GCCCCAATCAAGCGTAATGTGGACTCGATGGAAAGCATCCTGAGCTTTGCTGGAAACCTGTGGCTCAAAGGGTAT
GAGATCAATTGGTCAAAGGTCAATGGCCTCCAGACAGGGTTGAAGTCTGTGCGCTCTATGTACCGCGTGGTCACA
GATCTTCCACCGTATCGCTTCAACTACGAGAACATCCTCTGGAACGAATGCCGCGCCAGTGTTGAATACAGGCAG
CGCAAGTATCCGCATCATGAACTCCTGGGTAGCCTACTCACCGGTGGAAATGCCCGCGACAAGATCTTCCGCAAT
ATCCTCAAGGTGGATGATGTCTCCTGGCTTAAGGACCATAAGCTTGGTGATACGGTCGTTTTCCCTGGTGCAGGG
TATTTGGCGATGGCGATGGAGGCTGTTATGCAGGCCACCGACGCGGCGCGCACGGACCCTACATTTCAATTCTCC
AACGTCAACATCACGAACGCGTTGACCTTGAACACAGAATTCTCGACCAGCGCGGAGATCTTCACTTCTCTGCAC
AAGTCTGTCATTACCAATGCAGCCACATCAGCCACCTGGTGGGACTTTGCTATATCAAGCTACCACAATGGATCT
GCGGTACAGCATGCATCTGGATCGATCGCTATTCACCCACGCAACGCGGCTCTGCAGTCAAAATATAAGCCACCA
AGCGGAGCGCTTGAATCCACAGCCAAGCGGACTTGGTACGAAAAATTCATCAGGCAGGGGTTGAACTATGGCCCA
ACCTTCCAAACCATCTCCGAATTTTATACCCCGCGTATGAAATCGGAGTCGTTCGCTAGTGCTACAGCGCCTCTA
TTGAAGACAAGTGGCGATTCCATTTCGGTATATCCAGTGCACCCAATCGCTTTGGACGGCATGATCCAACTAGCT
GTGGTTGCAGCCACCAATGGCAAACCTAAGGAGTTACGTGCCCAGATACCCACGAGGCTGCCATCGGCAATCGTC
CACACTTCTACTTCCTCCAATCAGACTTGCCAAATGCATGCAGTCGTCAAACGGATTGGATTCGGATACACTCAT
GCTGGTATAGAAATGATTGACAGCGATGGACAAATTGTGGCTCAATTCGATGATATTCGACTCTCCCCGTACCAA
TCCACCAGTCAAGCAGACATAGAAGATAAGCGCCATCCAGTTCTTCGGGTACTTTGGAAGCCTGACATTTATGGA
CTGGGGCTCATGGCCATGGATGATGCGCAGCACCATGTCCAGAAGTTTGCTGATGAGGCCCATTCACCGGTGTCC
GGCCCGCTCCTCAAGATGGGCGCTATGCTGGACCTTTTGGCGCACAAAAATCCCCGCCTCCGTATTTTGGAAATT
GGAAATGATGTGCAAGACATCACCCTGGCTGTATTGGGACTTCTATCCGCACAGGGGAGCTTCAAGCGCCTGTCC
GCATATAGCACAGCATCAGTTTCTGATGATGGCACTATCTTGGGAGGTCTCTTAAACCTTGAGACTGGAGAGCGC
TGCTCCAGTCCCACTGAACTGGACCATGAGTATGACCTCATCCTACTTCCGGCGATGAACGAACATATCGACCGG
GCCGTGGATACCTTTGGCGGCTTGATGGCCGACGACGCATCCATTTTGGCCTTATGCCCCGGATTGACAAGCAAT
TCATTTGCCTCGCGTGGTCTCGATTGTCTTCCCGTCCGCCTTTCCGAGGATGGTACAACACTTATCGTTGCGCGC
AAGCCGCAGGAATTGCAACAAGTTTCACTGCAAAGGCACAAATTCCTCATCGTTGAGCGTGAGAAAACTGCGCTC
GGATCTGCACTGGCGGATACCCTGAAACCCATCCAAGGACAATGGGTGATGCGCGTCCGGCTAAATGAGCTCACA
CCCGCACATGTCTCGAGCGGGACAACAATTTTCAACCTCTGTGAGATAAAGTCTCCTCTTCTATCCGTCATCTCT
GACGATGAGATGGCCCGCGTCAAGGTCATGACAGACAACGCAACATTATTGGTGTGGGTTACCAATGGTAATATT
ATGCATGGTGACAGGCCGGACTTTGCTCTTGTATCTGGCCTGGCCCGAGCATTGATGCTAGAACAACCCTCGCTT
AAGCTCTACACCTATGATATTGACGAGCCTGAAACTCAAATCCATATGACTGCGAAGCGTCTGGTATCTCTTCTC
ACCCAGCCTGGTAAGAAGCCAGACCTAGAATTTGCGCAGCGCAAGGGGGTGGTCCACGTCTCGCGGTTCACACCC
GATGACAGCATTAATACCCTCTTCCGCAACAAGCAGGGACTTGAGACGACCGAGTCTAGCTTACACGATGCCAAA
GACGTGAGACTCGCCATCGAGCAAGCTGGGCAGCTGGACACTATTTATTTCCAGCAGCTGAAAGCTCCACAAACG
ATTGGCCCGACCGATTTGCGCATCCGGGTCGCGTCGGTCGGTCTCAATGCGAAAGACTATTATGTCTTGGTTGGA
CGAGTCGACACGCCCGACGCCACCTGTCAGTTGGAATGCGCTGGCACAGTCGAACAAGTAGGGTCTCTTGTGACA
GATTTCGCTCCCGGAGATCGTGTCGTTGCCATGGCACCAAGCCATTTCCAAACATATCAAACCCTTCCTCAGTGG
GCATGCCACAAGCTTACCGATGCGGAGAGCTTTGACATTAGCGCTACGTTACCTATAGTCTACGCCACCGCCATC
TATGCCTTGCACTACCGGGCCCATATCCAGGCTGGGGAGACGGTCTTGATTCATTCCGGAGCCGGCGGAGTTGGC
ATCGCGGCAATCCAATTAGCTCTACATGCAGGAGCGGAGGTAAGTCGAATTGAAACCGTTCAATTTATGGAATGC
ATGCTAACAAAACCATTGTGAAGGTGTTCACCACTGTCTCTTCAGATGAGAAGAAAAAGTTCTTGGTGGATAAAC
TTGGCGTCAAAGCATCCAACATCTTCAGCTCTCGCGATACTTCTTTCCTCGAGGGTATCTTCAGTGCTACGTCTG
GGCGCGGCGTAGACGTCATTCTCAACTCTCTGACAGGCGATCAGCTACACGCGACGTGGAGGTGCTGTGCAGCGT
TTGGTCGTTTTGTGGAGATTGGCAAGATGGACCTTACCACCGCTGGCCGTCTAGAAATGGACCAATTCCTACAAA
GTACCACTTTCACAGCCTTCGATCTCAGCCATCTCTACCACACCGATAGTGAGCAGCTTCACTCTCTATGGAATG
ACCTTCTTTCCCAGGCCATGAAACTCTACCGGCAGGGAACCATCACCGCGTTCGAGCCGCTGAATATTTTTGATA
TCGGTGAGACTGAGCAGGCATTCCGTTACTTCTCATCGCGCAGCAGAATCGGCAAGGTGGCCATTAATCTTGAAC
GGGCTGAGTCCACCATCCCAATCCAACCCCTGAGGCACACCACGCAATTTGACAGTGAGAAGAGCTATGTGATGG
TAGGCTGCTTGGGCGGTCTGGGGCGCACTCTTTCGCGTTGGATGGTCAACCGAGGTGCCCGGAAATTTACCTTCC
TAGGTCGATCCGGTATTGACAAGGCAGCTGCACGCCACCTGGTCCAAGACCTCGAAGCATCAGGTGCCAGATGCG
AGGTAGTCAGAGGTGACGTTTGCGAGGCGTCTGATGTCGAAGCCGTTATCACTGCGGCTGCCGCCATGGGTGAGA
TTGGCGGAGTTGTGCAGGCGGCCATGGGTCTGAATGAAGCAATTTTCTCTGTCATGCCCAACGAATACTGGCATA
CTGGCATCGACCCCAAAGTACAAGGATCTTGGAATTTGTACAACAGCCTGCAGATGCACGGACGGGGCTCTCATC
TTGATTTCTTCCTGATGACTTCCTCCGTCTCTGGCAGCGTCGGTACTGCGACCGAGTCTAACTACTGTGCCGCAA
ACCATTTCCTTGACCAGTTCTCTCGCTTCCTGCGCAACCAAGGATATCCGGCCGTTGCGGTTGGCTTGGGTATGA
TCTCAGAAGTCGGCTATCTACATGATAATCCCGAAATTGAGGCCCTCCTTTTACGCAAAGGGATTCAGGCCATTG
ATGCCGACGAGCTCCTCCAGCTCATTGATCTTGCCTTGTCATCCAGCGCTACAATGGGAATATCGCACGCACACG
ATGAATTAGCCGCTTCCCATCTTCTGACGGGTCTAGAAGCCTTCGGACTAAAGGAATTGCGCAAGAGAGGCTTCG
AAGGGTCCCATCCAGCTTTGGACGATCCACGCGCCAATCTTTTAGCCAGCGCCTTGGACGGTGGCTCGGATGAGT
CATCGCAAGCGCAGAACGGAAGCCTACCTGCTGAGGTTACGACCCTGATGCAATCAGGTCACACCCTCGACGAGG
CTGTGCTGGATCACATCCGCCGGCGATTTGGCAACCTCGTCCTTTTGAAGTACGAGGTTGTGGATGTCAAGAAGC
CTTTGCTGCAATACGGCATGGACAGTATGATTGGGGCTGAATTCCGAACATGGTTCTACCAGAGCTTGACAACCG
ATGTGCCGTTGGTCATGTTGCTCGGCTCGTCCTGCACGCTCGAGTCACTTAGGGACCTGGCGATGACCAGCTTGG
AAGTGGGAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail