Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5782.t1
Gene name
Locationscaffold_14:433854..435366
Strand+
Gene length (bp)1512
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 6.9E-99 25 388

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5782.t1
MAEVTRPPTKAWATLSPWLPSRGPDADYWWRLTGQHLSNMVEAAGYSTDQQYVALLFHYHWIVPYMGPAPGPDGN
LKWKSLLGVEGSPIEYSWKWNTAAGKPDVRYTTEAIGSFTGTLLDPLNQQATLEMLHRIADFVPTVDLTWTNHFF
ATLYDHDRSKYAKEAAAGAHFTTTVVVAAEWLKNGLNLKTYFVPRRLGQSDGKLPIALWEESLKQLDPNSESRAA
MHEFLNNDPEGKLLSPFMLAVDNVVPEKSRLKFYFQSPHTSFASVRQVMTMGGRIPVPESQLQELRSLIAAVTGL
DSDFPEDSEVPCISEYNPAAKDNFVEIDLLLSGYLYYFDIAPGATVPDIKFYTPVRRYGPDDGALAKGIADWMTS
RGRGEYSQRYLDMLADLTEHRKLEDGKGMQTYVSCLFKKSHLDVTSYIGPEAFDPARFLKHKVHTTRSTRRRSDS
H*
Coding >Pro_DTO377G3_2|g5782.t1
ATGGCTGAAGTGACAAGACCACCCACCAAGGCATGGGCAACTCTATCACCATGGCTGCCCTCACGAGGGCCTGAT
GCAGATTATTGGTGGAGACTGACAGGCCAGCATCTGTCTAACATGGTCGAGGCTGCTGGATACTCAACAGACCAG
CAATATGTGGCACTTCTCTTCCACTATCATTGGATCGTTCCCTACATGGGCCCCGCACCTGGACCAGACGGCAAC
CTCAAATGGAAATCTTTGCTGGGAGTTGAAGGGTCTCCGATTGAATATTCTTGGAAATGGAATACTGCGGCAGGC
AAGCCCGATGTCCGCTACACCACAGAGGCAATTGGCTCCTTCACAGGAACCCTTTTGGATCCTCTGAACCAGCAA
GCCACACTTGAGATGCTGCATCGCATAGCAGATTTCGTGCCAACTGTGGACCTTACCTGGACCAACCATTTCTTC
GCCACCCTCTACGATCATGACCGCTCCAAATATGCCAAGGAAGCGGCGGCAGGTGCGCACTTCACCACTACGGTG
GTAGTCGCCGCGGAGTGGCTCAAGAATGGTCTGAATCTCAAAACGTATTTTGTTCCCCGTCGTCTGGGTCAATCG
GATGGGAAGTTGCCCATCGCTCTGTGGGAAGAATCACTCAAGCAGCTTGATCCGAACAGTGAATCTCGAGCCGCA
ATGCACGAATTCCTCAACAATGACCCGGAAGGAAAATTGCTGAGCCCCTTCATGCTGGCTGTTGATAATGTCGTC
CCTGAAAAATCGAGGCTCAAGTTCTACTTCCAATCTCCCCATACCAGCTTTGCCTCTGTGCGGCAGGTCATGACA
ATGGGAGGGCGCATCCCCGTCCCTGAATCGCAGCTCCAGGAGCTCCGCAGTCTCATTGCAGCTGTTACAGGCCTA
GACTCGGACTTCCCTGAGGATTCTGAGGTCCCTTGCATATCAGAGTACAACCCAGCCGCTAAAGATAACTTCGTT
GAGATTGATCTTTTGCTTTCTGGGTATTTATACTATTTCGATATTGCTCCTGGAGCAACAGTGCCGGATATCAAA
TTTTATACTCCTGTTCGTCGCTATGGACCGGACGATGGTGCTCTTGCAAAAGGCATCGCTGACTGGATGACATCT
CGCGGAAGGGGTGAATATAGCCAGAGATACCTGGACATGCTTGCAGATCTCACCGAGCATCGCAAACTAGAAGAT
GGAAAGGGTATGCAGACATACGTTAGTTGTCTGTTCAAGAAGAGCCACTTGGACGTTACGTCCTATATTGGCCCG
GAGGCATTTGATCCCGCCCGCTTTCTGAAGCATAAAGTACACACCACCCGGTCCACCCGAAGACGGAGCGATAGT
CATTGA
Transcript >Pro_DTO377G3_2|g5782.t1
ATGGCTGAAGTGACAAGACCACCCACCAAGGCATGGGCAACTCTATCACCATGGCTGCCCTCACGAGGGCCTGAT
GCAGATTATTGGTGGAGACTGACAGGCCAGCATCTGTCTAACATGGTCGAGGCTGCTGGATACTCAACAGACCAG
CAATATGTGGCACTTCTCTTCCACTATCATTGGATCGTTCCCTACATGGGCCCCGCACCTGGACCAGACGGCAAC
CTCAAATGGAAATCTTTGCTGGGAGTTGAAGGGTCTCCGATTGAATATTCTTGGAAATGGAATACTGCGGCAGGC
AAGCCCGATGTCCGCTACACCACAGAGGCAATTGGCTCCTTCACAGGAACCCTTTTGGATCCTCTGAACCAGCAA
GCCACACTTGAGATGCTGCATCGCATAGCAGATTTCGTGCCAACTGTGGACCTTACCTGGACCAACCATTTCTTC
GCCACCCTCTACGATCATGACCGCTCCAAATATGCCAAGGAAGCGGCGGCAGGTGCGCACTTCACCACTACGGTG
GTAGTCGCCGCGGAGTGGCTCAAGAATGGTCTGAATCTCAAAACGTATTTTGTTCCCCGTCGTCTGGGTCAATCG
GATGGGAAGTTGCCCATCGCTCTGTGGGAAGAATCACTCAAGCAGCTTGATCCGAACAGTGAATCTCGAGCCGCA
ATGCACGAATTCCTCAACAATGACCCGGAAGGAAAATTGCTGAGCCCCTTCATGCTGGCTGTTGATAATGTCGTC
CCTGAAAAATCGAGGCTCAAGTTCTACTTCCAATCTCCCCATACCAGCTTTGCCTCTGTGCGGCAGGTCATGACA
ATGGGAGGGCGCATCCCCGTCCCTGAATCGCAGCTCCAGGAGCTCCGCAGTCTCATTGCAGCTGTTACAGGCCTA
GACTCGGACTTCCCTGAGGATTCTGAGGTCCCTTGCATATCAGAGTACAACCCAGCCGCTAAAGATAACTTCGTT
GAGATTGATCTTTTGCTTTCTGGGTATTTATACTATTTCGATATTGCTCCTGGAGCAACAGTGCCGGATATCAAA
TTTTATACTCCTGTTCGTCGCTATGGACCGGACGATGGTGCTCTTGCAAAAGGCATCGCTGACTGGATGACATCT
CGCGGAAGGGGTGAATATAGCCAGAGATACCTGGACATGCTTGCAGATCTCACCGAGCATCGCAAACTAGAAGAT
GGAAAGGGTATGCAGACATACGTTAGTTGTCTGTTCAAGAAGAGCCACTTGGACGTTACGTCCTATATTGGCCCG
GAGGCATTTGATCCCGCCCGCTTTCTGAAGCATAAAGTACACACCACCCGGTCCACCCGAAGACGGAGCGATAGT
CATTGA
Gene >Pro_DTO377G3_2|g5782.t1
ATGGCTGAAGTGACAAGACCACCCACCAAGGCATGGGCAACTCTATCACCATGGCTGCCCTCACGAGGGCCTGAT
GCAGATTATTGGTGGAGACTGACAGGCCAGCATCTGTCTAACATGGTCGAGGCTGCTGGATACTCAACAGACCAG
CAATATGTGGCACTTCTCTTCCACTATCATTGGATCGTGCGCATCCCTGTTCCTTTTCCCCCACTCTTCCTCTCC
ATGTTTCACTAGAAACGCAGCAACACTAACGGAGTGGCTAGCATAGGTTCCCTACATGGGCCCCGCACCTGGACC
AGACGGCAACCTCAAATGGAAATCTTTGCTGGGAGTTGAAGGGTCTCCGATTGAATATTCTTGGAAATGGAATAC
TGCGGCAGGCAAGCCCGATGTCCGCTACACCACAGAGGCAATTGGCTCCTTCACAGGAACCCTTTTGGATCCTCT
GAACCAGCAAGCCACACTTGAGATGCTGCATCGCATAGCAGATTTCGTGCCAACTGTGGACCTTACCTGGACCAA
CCATTTCTTCGCCACCCTCTACGATCATGACCGCTCCAAATATGCCAAGGAAGCGGCGGCAGGTGCGCACTTCAC
CACTACGGTGGTAGTCGCCGCGGAGTGGCTCAAGAATGGTCTGAATCTCAAAACGTATTTTGTTCCCCGTCGTCT
GGGTCAATCGGATGGGAAGTTGCCCATCGCTCTGTGGGAAGAATCACTCAAGCAGCTTGATCCGAACAGTGAATC
TCGAGCCGCAATGCACGAATTCCTCAACAATGACCCGGAAGGAAAATTGCTGAGCCCCTTGTGAGCCTTTATCTT
TGCATCTCAATAATAGATGCTTCCTCGTTTGGAATATTGCTAACGAGAATTCTTAGCATGCTGGCTGTTGATAAT
GTCGTCCCTGAAAAATCGAGGCTCAAGTTCTACTTCCAATCTCCCCATACCAGCTTTGCCTCTGTGCGGCAGGTC
ATGACAATGGGAGGGCGCATCCCCGTCCCTGAATCGCAGCTCCAGGAGCTCCGCAGTCTCATTGCAGCTGTTACA
GGCCTAGACTCGGACTTCCCTGAGGATTCTGAGGTCCCTTGCATATCAGAGTACAACCCAGCCGCTAAAGATAAC
TTCGTTGAGATTGATCTTTTGCTTTCTGGGTATTTATACTATTTCGATATTGCTCCTGGAGCAACAGTGCCGGAT
ATCAAATTTTATACTCCTGTTCGTCGCTATGGACCGGACGATGGTGCTCTTGCAAAAGGCATCGCTGACTGGATG
ACATCTCGCGGAAGGGGTGAATATAGCCAGAGATACCTGGACATGCTTGCAGATCTCACCGAGCATCGCAAACTA
GAAGATGGAAAGGGTATGCAGACATACGTTAGTTGTCTGTTCAAGAAGAGCCACTTGGACGTTACGTCCTATATT
GGCCCGGAGGCATTTGATCCCGCCCGCTTTCTGAAGCATAAAGTACACACCACCCGGTCCACCCGAAGACGGAGC
GATAGTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail