Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5780.t1
Gene name
Locationscaffold_14:429208..431794
Strand-
Gene length (bp)2586
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.4E-08 16 187
PF01494 FAD_binding_3 FAD binding domain 3.0E-05 311 357

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 472 494 22
2 539 558 19
3 573 595 22
4 615 633 18
5 648 667 19
6 688 710 22
7 746 768 22
8 777 799 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5780.t1
MLHSPPPFADGLRPLKVIIIGGGIAGLSLANAFEKAPVPIEYVILEARDTIAPQVGAGIALAPSGCRILDQLGVY
DDLEQLVHPVQSSGVCDGQGKSLLPERSDTALLVTARMSYPLGWVERRSVLQVLFKHICHKKSVLTSKRMDRIEH
SREQEKPIKVICTDGSFYEGDLVVGADGVHSKTRSEMWRAVEQNICDDFDVQQERRAMMAEYQCMFGISSPIPGL
DAGMTDDTLARDVSMVVASGKDGKIFWFLFKRMPQVYQSHEIPRFDSADALKFAEQYFDFPVQSGASNIKFSDLW
ERRETATLVPLEEADFAHWTAGRIVCLGDSAHKMTPHTGTGGMLALEHAAVLANIICRLVAQGNKLPLTTSQIGM
ALSQYDEKRRHRRTSAKIKSTGASARMQTLQSLADRLVVRFLLPYAGDIRADQFCDDAIGAEHIEYMPVPARSMT
GLMPFNPNRGIGMHESIWPRVLWALPLLGMAVAGLLTMFSVAPFEDAYDFLARRRYREVELRDKFYHSGLLDDFS
RSGVLRFIVSEAHFFYQPFSFFADYGVWYGIMLVESARRANRLNVLSFALLWGMLNMWGIAIFVPIYYFAYYILT
PISTFDASDRRLTNLSYTKTILPVLLATHYATFMDAYLSPVRSHRQAAGFLWELFPVWLSLAQAGLARKFLQPST
LKQDRLNNVTRDLPTIRTTILGLCAVSTAVWQYTVWCSEDSLGNIFIPIRSSVQGQTFEQLFAEFLKWDQVFFAI
PNLFWIILLFADLRAAGLIHAGWLKISFSALGLIIAGGNGTMLGLMWLYREEVLAKRQDRGAVVRPIA*
Coding >Pro_DTO377G3_2|g5780.t1
ATGTTGCACTCTCCTCCTCCCTTTGCTGATGGGCTTCGCCCCCTCAAAGTCATCATTATAGGAGGTGGGATTGCT
GGTCTATCTTTGGCGAATGCCTTTGAAAAAGCCCCTGTCCCGATCGAATACGTAATTCTGGAAGCTCGAGACACC
ATTGCACCACAGGTCGGAGCTGGTATTGCTCTTGCCCCAAGCGGGTGTCGAATTCTCGACCAATTGGGTGTGTAT
GACGATTTGGAACAGCTGGTTCATCCGGTGCAAAGCAGCGGTGTGTGTGATGGACAGGGAAAGTCGTTATTGCCC
GAGCGGAGTGACACCGCATTGCTCGTCACTGCGCGCATGTCATATCCGTTGGGATGGGTCGAGCGTCGAAGTGTC
TTGCAAGTGCTGTTTAAGCACATCTGTCACAAGAAAAGTGTGTTGACGAGCAAGAGGATGGATCGGATCGAACAC
TCCCGTGAGCAAGAGAAGCCTATCAAGGTCATCTGCACCGATGGCTCTTTCTATGAAGGCGATCTGGTCGTGGGA
GCCGATGGAGTTCACAGTAAAACGCGCTCGGAGATGTGGAGGGCGGTTGAGCAAAATATCTGTGATGATTTTGAT
GTGCAGCAGGAACGTCGAGCCATGATGGCTGAATATCAGTGCATGTTTGGTATCTCTAGCCCCATTCCGGGGTTG
GACGCTGGTATGACCGACGACACGCTTGCAAGAGACGTGTCTATGGTAGTGGCTAGTGGCAAGGACGGCAAGATT
TTTTGGTTTTTGTTCAAACGTATGCCACAAGTATACCAAAGCCATGAGATTCCGCGATTCGATAGCGCGGATGCG
TTAAAATTTGCAGAGCAATATTTTGATTTCCCTGTCCAGTCCGGTGCGAGCAACATTAAGTTTTCTGATCTGTGG
GAGCGGCGCGAGACGGCAACACTAGTCCCTCTCGAGGAGGCAGACTTCGCGCATTGGACAGCTGGTCGCATTGTT
TGCTTGGGCGACAGTGCTCACAAAATGACACCCCATACTGGGACCGGAGGCATGCTTGCTCTCGAACATGCAGCA
GTGTTGGCCAACATAATATGCCGGTTGGTGGCCCAGGGAAACAAATTACCGCTCACAACATCTCAAATCGGAATG
GCCCTGAGTCAATACGATGAAAAAAGACGACACCGTCGCACCTCCGCTAAAATAAAGTCTACCGGAGCGTCTGCT
CGCATGCAGACTTTACAGAGTCTTGCGGATCGGCTTGTTGTTCGTTTCCTTTTACCTTACGCTGGTGATATTCGT
GCCGATCAATTTTGCGATGATGCCATTGGCGCAGAGCATATTGAATACATGCCAGTTCCAGCGCGCTCTATGACG
GGTTTGATGCCTTTTAATCCCAATCGTGGTATCGGTATGCATGAAAGCATATGGCCACGCGTGTTGTGGGCCTTG
CCACTACTTGGGATGGCAGTTGCTGGGTTGTTGACTATGTTCTCCGTGGCGCCATTTGAAGATGCATACGACTTC
CTTGCTCGTCGTCGCTACCGCGAAGTGGAACTCCGAGACAAATTCTACCACTCTGGTTTGCTCGATGATTTCTCC
AGGTCGGGAGTCCTGCGCTTCATAGTCAGTGAAGCGCACTTCTTTTATCAGCCTTTCTCCTTTTTTGCCGACTAT
GGTGTTTGGTATGGTATCATGTTGGTTGAGTCTGCAAGGAGAGCTAACCGACTCAACGTCCTAAGTTTTGCTCTT
CTCTGGGGAATGCTCAATATGTGGGGAATCGCCATTTTCGTTCCCATTTATTACTTTGCTTACTACATCCTCACG
CCAATTTCCACCTTTGACGCATCCGACAGGCGTCTAACAAATCTTTCCTATACAAAGACTATCCTGCCAGTGCTT
TTGGCTACCCACTATGCCACTTTTATGGACGCTTATCTTTCTCCGGTGCGGTCCCACCGTCAGGCTGCTGGCTTC
TTGTGGGAGCTATTCCCTGTCTGGCTCTCTCTTGCACAGGCGGGCCTTGCTCGAAAATTCCTCCAACCGAGCACG
CTGAAGCAAGATCGACTCAATAATGTTACACGCGATCTACCGACTATCCGAACAACCATTCTCGGGCTTTGTGCC
GTTTCGACTGCAGTTTGGCAGTATACAGTCTGGTGCAGCGAGGACTCGCTTGGAAACATCTTCATACCCATCCGT
AGTAGTGTGCAGGGCCAAACTTTTGAACAGCTCTTTGCCGAGTTCTTGAAATGGGATCAAGTATTCTTCGCTATT
CCGAATTTGTTTTGGATTATACTATTGTTTGCTGATCTTCGTGCCGCTGGCTTGATTCATGCTGGTTGGCTCAAA
ATATCATTCTCGGCTCTGGGTCTGATAATTGCGGGTGGGAATGGGACGATGCTAGGATTGATGTGGCTGTATAGG
GAAGAGGTTCTGGCAAAGAGACAAGATCGAGGCGCTGTTGTGCGTCCCATAGCCTGA
Transcript >Pro_DTO377G3_2|g5780.t1
ATGTTGCACTCTCCTCCTCCCTTTGCTGATGGGCTTCGCCCCCTCAAAGTCATCATTATAGGAGGTGGGATTGCT
GGTCTATCTTTGGCGAATGCCTTTGAAAAAGCCCCTGTCCCGATCGAATACGTAATTCTGGAAGCTCGAGACACC
ATTGCACCACAGGTCGGAGCTGGTATTGCTCTTGCCCCAAGCGGGTGTCGAATTCTCGACCAATTGGGTGTGTAT
GACGATTTGGAACAGCTGGTTCATCCGGTGCAAAGCAGCGGTGTGTGTGATGGACAGGGAAAGTCGTTATTGCCC
GAGCGGAGTGACACCGCATTGCTCGTCACTGCGCGCATGTCATATCCGTTGGGATGGGTCGAGCGTCGAAGTGTC
TTGCAAGTGCTGTTTAAGCACATCTGTCACAAGAAAAGTGTGTTGACGAGCAAGAGGATGGATCGGATCGAACAC
TCCCGTGAGCAAGAGAAGCCTATCAAGGTCATCTGCACCGATGGCTCTTTCTATGAAGGCGATCTGGTCGTGGGA
GCCGATGGAGTTCACAGTAAAACGCGCTCGGAGATGTGGAGGGCGGTTGAGCAAAATATCTGTGATGATTTTGAT
GTGCAGCAGGAACGTCGAGCCATGATGGCTGAATATCAGTGCATGTTTGGTATCTCTAGCCCCATTCCGGGGTTG
GACGCTGGTATGACCGACGACACGCTTGCAAGAGACGTGTCTATGGTAGTGGCTAGTGGCAAGGACGGCAAGATT
TTTTGGTTTTTGTTCAAACGTATGCCACAAGTATACCAAAGCCATGAGATTCCGCGATTCGATAGCGCGGATGCG
TTAAAATTTGCAGAGCAATATTTTGATTTCCCTGTCCAGTCCGGTGCGAGCAACATTAAGTTTTCTGATCTGTGG
GAGCGGCGCGAGACGGCAACACTAGTCCCTCTCGAGGAGGCAGACTTCGCGCATTGGACAGCTGGTCGCATTGTT
TGCTTGGGCGACAGTGCTCACAAAATGACACCCCATACTGGGACCGGAGGCATGCTTGCTCTCGAACATGCAGCA
GTGTTGGCCAACATAATATGCCGGTTGGTGGCCCAGGGAAACAAATTACCGCTCACAACATCTCAAATCGGAATG
GCCCTGAGTCAATACGATGAAAAAAGACGACACCGTCGCACCTCCGCTAAAATAAAGTCTACCGGAGCGTCTGCT
CGCATGCAGACTTTACAGAGTCTTGCGGATCGGCTTGTTGTTCGTTTCCTTTTACCTTACGCTGGTGATATTCGT
GCCGATCAATTTTGCGATGATGCCATTGGCGCAGAGCATATTGAATACATGCCAGTTCCAGCGCGCTCTATGACG
GGTTTGATGCCTTTTAATCCCAATCGTGGTATCGGTATGCATGAAAGCATATGGCCACGCGTGTTGTGGGCCTTG
CCACTACTTGGGATGGCAGTTGCTGGGTTGTTGACTATGTTCTCCGTGGCGCCATTTGAAGATGCATACGACTTC
CTTGCTCGTCGTCGCTACCGCGAAGTGGAACTCCGAGACAAATTCTACCACTCTGGTTTGCTCGATGATTTCTCC
AGGTCGGGAGTCCTGCGCTTCATAGTCAGTGAAGCGCACTTCTTTTATCAGCCTTTCTCCTTTTTTGCCGACTAT
GGTGTTTGGTATGGTATCATGTTGGTTGAGTCTGCAAGGAGAGCTAACCGACTCAACGTCCTAAGTTTTGCTCTT
CTCTGGGGAATGCTCAATATGTGGGGAATCGCCATTTTCGTTCCCATTTATTACTTTGCTTACTACATCCTCACG
CCAATTTCCACCTTTGACGCATCCGACAGGCGTCTAACAAATCTTTCCTATACAAAGACTATCCTGCCAGTGCTT
TTGGCTACCCACTATGCCACTTTTATGGACGCTTATCTTTCTCCGGTGCGGTCCCACCGTCAGGCTGCTGGCTTC
TTGTGGGAGCTATTCCCTGTCTGGCTCTCTCTTGCACAGGCGGGCCTTGCTCGAAAATTCCTCCAACCGAGCACG
CTGAAGCAAGATCGACTCAATAATGTTACACGCGATCTACCGACTATCCGAACAACCATTCTCGGGCTTTGTGCC
GTTTCGACTGCAGTTTGGCAGTATACAGTCTGGTGCAGCGAGGACTCGCTTGGAAACATCTTCATACCCATCCGT
AGTAGTGTGCAGGGCCAAACTTTTGAACAGCTCTTTGCCGAGTTCTTGAAATGGGATCAAGTATTCTTCGCTATT
CCGAATTTGTTTTGGATTATACTATTGTTTGCTGATCTTCGTGCCGCTGGCTTGATTCATGCTGGTTGGCTCAAA
ATATCATTCTCGGCTCTGGGTCTGATAATTGCGGGTGGGAATGGGACGATGCTAGGATTGATGTGGCTGTATAGG
GAAGAGGTTCTGGCAAAGAGACAAGATCGAGGCGCTGTTGTGCGTCCCATAGCCTGA
Gene >Pro_DTO377G3_2|g5780.t1
ATGTTGCACTCTCCTCCTCCCTTTGCTGATGGGCTTCGCCCCCTCAAAGTCATCATTATAGGAGGTGGGATTGCT
GGTCTATCTTTGGCGAATGCCTTTGAAAAAGCCCCTGTCCCGATCGAATACGTAATTCTGGAAGCTCGAGACACC
ATTGCACCACAGGTCGGAGCTGGTATTGCTCTTGCCCCAAGCGGGTGTCGAATTCTCGACCAATTGGGTGTGTAT
GACGATTTGGAACAGCTGGTTCATCCGGTGCAAAGCAGCGGTGTGTGTGATGGACAGGGAAAGTCGTTATTGCCC
GAGCGGAGTGACACCGCATTGCTCGTCACTGCGCGCATGTCATATCCGTTGGGATGGGTCGAGCGTCGAAGTGTC
TTGCAAGTGCTGTTTAAGCACATCTGTCACAAGAAAAGTGTGTTGACGAGCAAGAGGATGGATCGGATCGAACAC
TCCCGTGAGCAAGAGAAGCCTATCAAGGTCATCTGCACCGATGGCTCTTTCTATGAAGGCGATCTGGTCGTGGGA
GCCGATGGAGTTCACAGTAAAACGCGCTCGGAGATGTGGAGGGCGGTTGAGCAAAATATCTGTGATGATTTTGAT
GTGCAGCAGGAACGTCGAGGTAAGTGGCCCTGAATCGTCGATTTATCACCCATCAATTTGTACGGATGTACTAAC
AGGGATAACAGCCATGATGGCTGAATATCAGTGCATGTTTGGTATCTCTAGCCCCATTCCGGGGTTGGACGCTGG
TATGACCGACGACACGCTTGCAAGAGACGTGTCTATGGTAGTGGCTAGTGGCAAGGACGGCAAGATTTTTTGGTT
TTTGTTCAAACGTATGCCACAAGTATACCAAAGCCATGAGATTCCGCGATTCGATAGCGCGGATGCGTTAAAATT
TGCAGAGCAATATTTTGATTTCCCTGTCCAGTCCGGTGCGAGCAACATTAAGTTTTCTGATCTGTGGGAGCGGCG
CGAGACGGCAACACTAGTCCCTCTCGAGGAGGCAGACTTCGCGCATTGGACAGCTGGTCGCATTGTTTGCTTGGG
CGACAGTGCTCACAAAATGACACCCCATACTGGGACCGGAGGCATGCTTGCTCTCGAACATGCAGCAGTGTTGGC
CAACATAATATGCCGGTTGGTGGCCCAGGGAAACAAATTACCGCTCACAACATCTCAAATCGGAATGGCCCTGAG
TCAATACGATGAAAAAAGACGACACCGTCGCACCTCCGCTAAAATAAAGTCTACCGGAGCGTCTGCTCGCATGCA
GACTTTACAGAGTCTTGCGGATCGGCTTGTTGTTCGTTTCCTTTTACCTTACGCTGGTGATATTCGTGCCGATCA
ATTTTGCGATGATGCCATTGGCGCAGAGCATATTGAATACATGCCAGTTCCAGCGCGCTCTATGACGGGTTTGAT
GCCTTTTAATCCCAATCGTGGTATCGGTATGCATGAAAGCATATGGCCACGCGTGTTGTGGGCCTTGCCACTACT
TGGGATGGCAGTTGCTGGGTTGTTGACTATGTTCTCCGTGGCGCCATTTGAAGATGCATACGACTTCCTTGCTCG
TCGTCGCTACCGCGAAGTGGAACTCCGAGACAAATTCTACCACTCTGGTTTGCTCGATGATTTCTCCAGGTCGGG
AGTCCTGCGCTTCATAGTCAGTGAAGCGCACTTCTTTTATCAGCCTTTCTCCTTTTTTGCCGACTATGGTGTTTG
GTATGGTATCATGTTGGTTGAGTCTGCAAGGAGAGCTAACCGACTCAACGTCCTAAGTTTGTAAGTTTGCGACAG
AGTGACCAACACTCTGGATGAGACCTTCTAACATACTATTTCACCAGTGCTCTTCTCTGGGGAATGCTCAATATG
TGGGGAATCGCCATTTTCGTTCCCATTTATTACTTTGCTTACTACATCCTCACGCCAATTTCCACCTTTGACGCA
TCCGACAGGCGTCTAACAAATCTTTCCTATACAAAGACTATCCTGCCAGTGCTTTTGGCTACCCACTATGCCACT
TTTATGGACGCTTATCTTTCTCCGGTGCGGTCCCACCGTCAGGCTGCTGGCTTCTTGTGGGAGCTATTCCCTGTC
TGGCTCTCTCTTGCACAGGCGGGCCTTGCTCGAAAATTCCTCCAACCGAGCACGCTGAAGCAAGATCGACTCAAT
AATGTTACACGCGATCTACCGACTATCCGAACAACCATTCTCGGGCTTTGTGCCGTTTCGACTGCAGTTTGGCAG
TATACAGTCTGGTGCAGCGAGGACTCGCTTGGAAACATCTTCATACCCATCCGTAGTAGTGTGCAGGGCCAAACT
TTTGAACAGCTCTTTGCCGAGTTCTTGAAATGGGATCAAGTATTCTTCGCTATTCCGAATTTGTTTTGGATTATA
CTATTGTTTGCTGATCTTCGTGCCGCTGGCTTGATTCATGCTGGTTGGCTCAAAATATCATTCTCGGCTCTGGGT
CTGATAATTGCGGGTGGGAATGGGACGATGCTAGGATTGATGTGGCTGTATAGGGAAGAGGTTCTGGCAAAGAGA
CAAGATCGAGGCGCTGTTGTGCGTCCCATAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail