Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5773.t1
Gene name
Locationscaffold_14:402612..406756
Strand+
Gene length (bp)4144
Transcript length (bp)4080
Coding sequence length (bp)4080
Protein length (aa) 1360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12455 Dynactin Dynein associated protein 1.4E-88 615 894
PF01302 CAP_GLY CAP-Gly domain 8.2E-23 9 70

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.22 3.11 9.33
5d_25C Five days - 25 degrees Celsius 5.72 2.79 8.65
7d_25C Seven days - 25 degrees Celsius 6.25 3.10 9.40
10d_25C Ten days - 25 degrees Celsius 4.89 2.27 7.50
7d_15C Seven days - 15 degrees Celsius 5.43 2.57 8.29
7d_30C Seven days - 30 degrees Celsius 7.86 4.14 11.59

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.841445 no
3d_25C 7d_25C 0.992023 no
3d_25C 7d_15C 0.717215 no
3d_25C 7d_30C 0.448839 no
3d_25C 10d_25C 0.470879 no
5d_25C 7d_25C 0.829498 no
5d_25C 7d_15C 0.906805 no
5d_25C 7d_30C 0.287937 no
5d_25C 10d_25C 0.684996 no
7d_25C 7d_15C 0.704686 no
7d_25C 7d_30C 0.463462 no
7d_25C 10d_25C 0.463330 no
7d_15C 7d_30C 0.192358 no
7d_15C 10d_25C 0.793709 no
7d_30C 10d_25C 0.089205 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5773.t1
MSGHALSVGTVIELPDGRLATVRFIGNTHFADGQWIGLELDEATGKNDGAVQGERYFDCYPGHGMFVRPTVVVKI
VQPEPESKQTAKLASSAAGSKAQPKPGISTGMRKQTGLPPTAARRQSSNAASTPTPVPKGVAALRSPTKSPTKQL
ATTTGRPSIGSTSRTSTVASNRPRLAPSTRSPPGPSPTQPTASRGSRPSVSGPAVRTSRPGSQSAVASSTPGLTK
RPSLRQVSNAKASDGGDAAMSGGSGDPTETESPDTDGEGAQDGLTGPKTSRQSMTASRPAASRPGAPLSASQRQG
QSSAVNRELEELNAKLRIMEKKRADDKEKLKTLEQLQAERDKFETIIQKLQAKYQPQQMEVTELRKKLKELEARS
DDVERMQAEHESLMEMATLDREMAEETAEAFKHECAALRSRLDELNLEVEVLREENEEYSQETTPEDRTTHGWLQ
MERTNERLREALIRLRDMTQQQELDLKSQIKELEEDLEEYATVKSDYEAAKERILVAETNVDNLKQQLETALGAE
EMIEELADKNMRYQDEINELKAAIEDLESLKEISDEMEYTHIETEKQLQEEIEYRESVFSDQCRKITQQDEVIED
LEYTLTRFRDLVTNLQCDLDDMRTTKQVSEAETTENALRHRQMQDLNMKLQANQSKALTKSIDVELNRMESEENA
QHLSMIKLYLPEYFEGEKNSIQALLRFKRVGFKANVMSSTLQDKGSEHSVVSNEELFQAHVVLEYLMWISNVCDR
FVNYITACSPEEFANIKIAMFEMEPVERMLNFWIEPMKKDEVNLAKFAVELQRSIALLAHLAETLLPSSLEMFAD
ELCMRAHLSQSYIEHSAGAIARVKLIISSKMVAAAEGDEENLISLNKLDTFASQARGYKVAMGKISRSLDDLRSR
SLALPKDAEEPFKTIENETKQLSEFARKLGENLVVLTSDEGRTHPFSPEEILDCMSQAAVSFASSSEILDESNDP
ISLLFTRLQQVGDQFEELDTISSDLSRTTEFERAAFPWVARAAELKSNKMTSPDADEEIRQLRNEIHEASAALGV
KDNTLEEQGLKIEHLESRMREASKKAAMVKELEARIEEIQKAGSELEKIVEQQKKELQTAEAERDEFMARLDRMK
RMSGTVGLTPTGNSAIIASEASLAAMDENESLRAEVESLQAAVRFLREENRRSNILDPYSVQRSSEMHAWLDAPL
VRAKPTPEQEKIQRTALESRDVMTHLLKLTKESRVPDLKSTMAVPGSDGNEKAGRAAWRPSKTRLRYQVLQQREN
FEHWAEWRDEIVNHEREQDRLAAAKQERTMRDRVSRHAHKASVEFPQGSGHGMMGRAWEILGMQKPRKIGPISTS
PDGVDIVTD*
Coding >Pro_DTO377G3_2|g5773.t1
ATGTCTGGCCATGCCTTATCTGTAGGCACGGTGATTGAGCTGCCCGATGGACGGCTAGCAACAGTGCGTTTCATT
GGCAACACCCATTTTGCGGACGGACAGTGGATAGGCCTTGAATTAGATGAAGCCACCGGCAAAAACGATGGCGCA
GTCCAAGGCGAACGGTATTTCGATTGCTATCCAGGACACGGCATGTTTGTCCGTCCAACGGTGGTTGTTAAGATT
GTCCAGCCCGAGCCGGAGAGTAAACAAACCGCCAAACTGGCTAGCAGCGCCGCAGGTAGCAAAGCGCAGCCTAAA
CCTGGGATCTCCACTGGTATGCGCAAGCAAACTGGGCTACCTCCTACAGCAGCAAGGCGACAGAGCAGCAATGCA
GCCTCAACTCCTACTCCGGTGCCGAAGGGTGTAGCCGCTCTCCGATCCCCTACGAAGTCCCCAACGAAACAACTC
GCAACGACTACGGGCCGCCCGTCCATCGGGAGTACTTCCCGCACCTCTACAGTGGCATCTAATCGACCACGACTA
GCTCCCAGCACCAGAAGCCCCCCGGGTCCCTCTCCAACACAGCCAACAGCCTCTAGAGGCTCACGGCCCTCGGTA
TCTGGACCAGCAGTCCGAACTTCAAGACCAGGCTCCCAAAGTGCCGTTGCTTCATCAACCCCGGGATTGACAAAG
CGTCCTTCACTACGGCAGGTTAGCAACGCAAAAGCATCGGATGGAGGAGACGCGGCCATGAGTGGGGGATCCGGA
GATCCAACCGAGACCGAGTCGCCTGACACTGACGGGGAGGGTGCACAAGACGGACTCACCGGGCCGAAGACCTCT
CGACAGTCGATGACTGCTTCGCGACCTGCAGCCTCGCGTCCTGGGGCCCCGCTCTCTGCATCTCAACGCCAGGGG
CAGAGCAGTGCAGTTAATCGCGAGCTCGAAGAACTTAATGCCAAGCTCAGAATAATGGAAAAGAAACGAGCCGAC
GACAAAGAGAAGTTGAAGACCCTCGAGCAACTCCAGGCTGAGCGTGATAAATTTGAAACGATCATCCAGAAACTT
CAAGCCAAGTATCAACCGCAGCAAATGGAAGTCACCGAGCTGCGCAAAAAGTTGAAAGAACTTGAGGCTCGTTCT
GACGACGTGGAACGCATGCAGGCGGAGCATGAATCGCTCATGGAAATGGCTACTCTTGACCGCGAAATGGCAGAG
GAGACAGCGGAGGCATTCAAACATGAGTGCGCAGCGTTACGATCAAGGTTGGACGAGCTGAATTTGGAGGTGGAG
GTTCTCCGAGAGGAGAATGAAGAATACAGCCAGGAGACCACCCCCGAAGACAGAACCACTCATGGATGGCTTCAG
ATGGAAAGAACCAATGAACGTCTCCGCGAGGCGCTCATTCGTTTAAGAGATATGACTCAGCAGCAAGAGTTAGAC
CTCAAGTCTCAGATCAAAGAATTGGAGGAGGATCTCGAGGAGTACGCTACCGTCAAGTCTGATTACGAGGCTGCA
AAGGAGAGAATTTTGGTCGCTGAGACCAATGTCGATAATCTTAAGCAGCAGCTGGAGACAGCACTGGGGGCGGAA
GAAATGATTGAAGAATTAGCAGACAAAAACATGCGCTACCAGGATGAGATTAATGAGCTGAAAGCTGCCATCGAG
GATTTGGAATCTCTCAAGGAGATTAGCGATGAGATGGAGTACACCCATATTGAGACTGAGAAGCAACTTCAAGAA
GAAATTGAGTACCGAGAGAGTGTGTTCAGCGACCAATGCCGAAAGATCACGCAACAGGACGAAGTTATCGAGGAC
CTTGAATATACATTAACGCGTTTCAGGGATTTGGTGACGAACCTGCAATGTGACTTGGATGATATGCGCACGACA
AAGCAAGTTTCGGAGGCAGAGACCACCGAAAATGCATTGCGCCACCGCCAGATGCAAGATTTGAATATGAAACTC
CAGGCCAATCAATCGAAGGCCCTGACCAAATCTATCGATGTTGAACTGAACCGTATGGAGTCCGAAGAAAATGCA
CAGCACCTTTCGATGATAAAGCTCTATCTTCCGGAGTACTTTGAAGGGGAAAAGAATTCTATTCAGGCTTTGCTT
CGATTCAAGCGCGTCGGATTCAAAGCCAATGTTATGAGCAGCACTCTACAAGATAAGGGATCTGAGCACTCAGTA
GTCTCCAACGAGGAACTTTTCCAAGCTCATGTGGTTTTGGAATATCTTATGTGGATTTCAAACGTGTGTGATCGC
TTTGTGAACTATATCACAGCTTGCTCGCCCGAGGAATTTGCCAATATCAAGATCGCAATGTTCGAAATGGAGCCA
GTGGAGCGCATGTTGAACTTCTGGATCGAGCCTATGAAGAAGGACGAAGTGAATCTTGCAAAGTTTGCAGTGGAA
TTGCAGCGGTCTATCGCTCTCCTCGCACACCTTGCTGAGACCCTTCTTCCTTCCAGCTTGGAGATGTTTGCCGAT
GAGCTGTGTATGCGGGCCCATTTGTCTCAATCGTACATTGAGCATTCAGCCGGTGCAATCGCACGCGTTAAGCTG
ATTATCAGCTCCAAGATGGTGGCCGCGGCAGAAGGCGACGAAGAAAACCTGATTTCTCTGAATAAATTGGACACC
TTCGCCTCTCAGGCCCGCGGATACAAGGTTGCGATGGGTAAGATCAGCCGGTCTCTTGATGATCTGCGTTCTAGG
TCACTTGCGCTCCCAAAGGACGCCGAAGAACCGTTCAAGACGATAGAGAATGAAACCAAGCAACTTTCAGAGTTT
GCTCGAAAGCTCGGCGAGAACCTTGTTGTCCTCACCAGTGATGAAGGTCGCACGCACCCATTTAGCCCGGAGGAG
ATTCTGGACTGTATGTCCCAGGCTGCCGTGTCCTTTGCCTCGTCCTCCGAAATCCTGGATGAAAGTAACGACCCT
ATATCATTGTTATTTACCAGATTGCAACAAGTAGGCGACCAATTTGAGGAGCTGGATACCATTTCATCAGATCTG
TCTCGCACGACAGAGTTCGAGAGAGCTGCATTCCCCTGGGTCGCTCGCGCTGCAGAATTGAAGTCCAACAAAATG
ACATCCCCGGATGCAGACGAGGAGATTCGCCAGTTGAGAAATGAGATTCACGAAGCGTCAGCCGCACTTGGAGTC
AAGGACAATACCCTTGAAGAACAGGGCCTAAAGATCGAGCATCTTGAATCAAGGATGCGAGAGGCGAGCAAGAAG
GCTGCCATGGTCAAAGAACTCGAAGCCAGAATCGAGGAAATCCAGAAAGCAGGGAGTGAACTCGAGAAAATAGTT
GAGCAACAAAAGAAGGAGCTTCAGACAGCCGAAGCAGAGCGAGATGAGTTCATGGCTCGTCTTGATCGAATGAAG
CGCATGTCTGGAACAGTAGGTCTGACGCCCACGGGTAACAGCGCCATCATCGCTAGTGAGGCCTCTTTAGCTGCC
ATGGACGAGAACGAGTCTCTCCGCGCTGAGGTGGAAAGCCTCCAAGCAGCTGTGCGTTTCCTGCGCGAGGAAAAC
CGCCGTTCGAACATCCTCGACCCATACTCCGTCCAGAGATCTAGTGAAATGCACGCATGGCTTGATGCGCCGCTC
GTGCGTGCCAAACCAACCCCCGAACAAGAAAAAATCCAACGCACTGCCCTCGAAAGTCGGGATGTCATGACCCAT
CTTCTCAAACTGACAAAAGAGTCCCGTGTCCCCGATCTCAAGTCCACGATGGCTGTTCCAGGTAGTGACGGCAAT
GAGAAAGCGGGTCGCGCTGCTTGGCGTCCGTCCAAGACCCGCCTCCGTTATCAGGTACTCCAGCAGCGCGAAAAC
TTCGAGCACTGGGCCGAATGGCGCGACGAAATTGTCAATCACGAACGTGAACAAGACCGTCTGGCTGCCGCTAAG
CAGGAGCGTACCATGCGTGATCGCGTCTCCAGACATGCTCACAAGGCTTCTGTCGAATTTCCCCAGGGCTCAGGC
CATGGTATGATGGGCCGTGCCTGGGAGATTCTCGGCATGCAAAAACCCCGCAAAATCGGCCCCATAAGTACTTCC
CCGGACGGTGTGGATATAGTCACGGACTAA
Transcript >Pro_DTO377G3_2|g5773.t1
ATGTCTGGCCATGCCTTATCTGTAGGCACGGTGATTGAGCTGCCCGATGGACGGCTAGCAACAGTGCGTTTCATT
GGCAACACCCATTTTGCGGACGGACAGTGGATAGGCCTTGAATTAGATGAAGCCACCGGCAAAAACGATGGCGCA
GTCCAAGGCGAACGGTATTTCGATTGCTATCCAGGACACGGCATGTTTGTCCGTCCAACGGTGGTTGTTAAGATT
GTCCAGCCCGAGCCGGAGAGTAAACAAACCGCCAAACTGGCTAGCAGCGCCGCAGGTAGCAAAGCGCAGCCTAAA
CCTGGGATCTCCACTGGTATGCGCAAGCAAACTGGGCTACCTCCTACAGCAGCAAGGCGACAGAGCAGCAATGCA
GCCTCAACTCCTACTCCGGTGCCGAAGGGTGTAGCCGCTCTCCGATCCCCTACGAAGTCCCCAACGAAACAACTC
GCAACGACTACGGGCCGCCCGTCCATCGGGAGTACTTCCCGCACCTCTACAGTGGCATCTAATCGACCACGACTA
GCTCCCAGCACCAGAAGCCCCCCGGGTCCCTCTCCAACACAGCCAACAGCCTCTAGAGGCTCACGGCCCTCGGTA
TCTGGACCAGCAGTCCGAACTTCAAGACCAGGCTCCCAAAGTGCCGTTGCTTCATCAACCCCGGGATTGACAAAG
CGTCCTTCACTACGGCAGGTTAGCAACGCAAAAGCATCGGATGGAGGAGACGCGGCCATGAGTGGGGGATCCGGA
GATCCAACCGAGACCGAGTCGCCTGACACTGACGGGGAGGGTGCACAAGACGGACTCACCGGGCCGAAGACCTCT
CGACAGTCGATGACTGCTTCGCGACCTGCAGCCTCGCGTCCTGGGGCCCCGCTCTCTGCATCTCAACGCCAGGGG
CAGAGCAGTGCAGTTAATCGCGAGCTCGAAGAACTTAATGCCAAGCTCAGAATAATGGAAAAGAAACGAGCCGAC
GACAAAGAGAAGTTGAAGACCCTCGAGCAACTCCAGGCTGAGCGTGATAAATTTGAAACGATCATCCAGAAACTT
CAAGCCAAGTATCAACCGCAGCAAATGGAAGTCACCGAGCTGCGCAAAAAGTTGAAAGAACTTGAGGCTCGTTCT
GACGACGTGGAACGCATGCAGGCGGAGCATGAATCGCTCATGGAAATGGCTACTCTTGACCGCGAAATGGCAGAG
GAGACAGCGGAGGCATTCAAACATGAGTGCGCAGCGTTACGATCAAGGTTGGACGAGCTGAATTTGGAGGTGGAG
GTTCTCCGAGAGGAGAATGAAGAATACAGCCAGGAGACCACCCCCGAAGACAGAACCACTCATGGATGGCTTCAG
ATGGAAAGAACCAATGAACGTCTCCGCGAGGCGCTCATTCGTTTAAGAGATATGACTCAGCAGCAAGAGTTAGAC
CTCAAGTCTCAGATCAAAGAATTGGAGGAGGATCTCGAGGAGTACGCTACCGTCAAGTCTGATTACGAGGCTGCA
AAGGAGAGAATTTTGGTCGCTGAGACCAATGTCGATAATCTTAAGCAGCAGCTGGAGACAGCACTGGGGGCGGAA
GAAATGATTGAAGAATTAGCAGACAAAAACATGCGCTACCAGGATGAGATTAATGAGCTGAAAGCTGCCATCGAG
GATTTGGAATCTCTCAAGGAGATTAGCGATGAGATGGAGTACACCCATATTGAGACTGAGAAGCAACTTCAAGAA
GAAATTGAGTACCGAGAGAGTGTGTTCAGCGACCAATGCCGAAAGATCACGCAACAGGACGAAGTTATCGAGGAC
CTTGAATATACATTAACGCGTTTCAGGGATTTGGTGACGAACCTGCAATGTGACTTGGATGATATGCGCACGACA
AAGCAAGTTTCGGAGGCAGAGACCACCGAAAATGCATTGCGCCACCGCCAGATGCAAGATTTGAATATGAAACTC
CAGGCCAATCAATCGAAGGCCCTGACCAAATCTATCGATGTTGAACTGAACCGTATGGAGTCCGAAGAAAATGCA
CAGCACCTTTCGATGATAAAGCTCTATCTTCCGGAGTACTTTGAAGGGGAAAAGAATTCTATTCAGGCTTTGCTT
CGATTCAAGCGCGTCGGATTCAAAGCCAATGTTATGAGCAGCACTCTACAAGATAAGGGATCTGAGCACTCAGTA
GTCTCCAACGAGGAACTTTTCCAAGCTCATGTGGTTTTGGAATATCTTATGTGGATTTCAAACGTGTGTGATCGC
TTTGTGAACTATATCACAGCTTGCTCGCCCGAGGAATTTGCCAATATCAAGATCGCAATGTTCGAAATGGAGCCA
GTGGAGCGCATGTTGAACTTCTGGATCGAGCCTATGAAGAAGGACGAAGTGAATCTTGCAAAGTTTGCAGTGGAA
TTGCAGCGGTCTATCGCTCTCCTCGCACACCTTGCTGAGACCCTTCTTCCTTCCAGCTTGGAGATGTTTGCCGAT
GAGCTGTGTATGCGGGCCCATTTGTCTCAATCGTACATTGAGCATTCAGCCGGTGCAATCGCACGCGTTAAGCTG
ATTATCAGCTCCAAGATGGTGGCCGCGGCAGAAGGCGACGAAGAAAACCTGATTTCTCTGAATAAATTGGACACC
TTCGCCTCTCAGGCCCGCGGATACAAGGTTGCGATGGGTAAGATCAGCCGGTCTCTTGATGATCTGCGTTCTAGG
TCACTTGCGCTCCCAAAGGACGCCGAAGAACCGTTCAAGACGATAGAGAATGAAACCAAGCAACTTTCAGAGTTT
GCTCGAAAGCTCGGCGAGAACCTTGTTGTCCTCACCAGTGATGAAGGTCGCACGCACCCATTTAGCCCGGAGGAG
ATTCTGGACTGTATGTCCCAGGCTGCCGTGTCCTTTGCCTCGTCCTCCGAAATCCTGGATGAAAGTAACGACCCT
ATATCATTGTTATTTACCAGATTGCAACAAGTAGGCGACCAATTTGAGGAGCTGGATACCATTTCATCAGATCTG
TCTCGCACGACAGAGTTCGAGAGAGCTGCATTCCCCTGGGTCGCTCGCGCTGCAGAATTGAAGTCCAACAAAATG
ACATCCCCGGATGCAGACGAGGAGATTCGCCAGTTGAGAAATGAGATTCACGAAGCGTCAGCCGCACTTGGAGTC
AAGGACAATACCCTTGAAGAACAGGGCCTAAAGATCGAGCATCTTGAATCAAGGATGCGAGAGGCGAGCAAGAAG
GCTGCCATGGTCAAAGAACTCGAAGCCAGAATCGAGGAAATCCAGAAAGCAGGGAGTGAACTCGAGAAAATAGTT
GAGCAACAAAAGAAGGAGCTTCAGACAGCCGAAGCAGAGCGAGATGAGTTCATGGCTCGTCTTGATCGAATGAAG
CGCATGTCTGGAACAGTAGGTCTGACGCCCACGGGTAACAGCGCCATCATCGCTAGTGAGGCCTCTTTAGCTGCC
ATGGACGAGAACGAGTCTCTCCGCGCTGAGGTGGAAAGCCTCCAAGCAGCTGTGCGTTTCCTGCGCGAGGAAAAC
CGCCGTTCGAACATCCTCGACCCATACTCCGTCCAGAGATCTAGTGAAATGCACGCATGGCTTGATGCGCCGCTC
GTGCGTGCCAAACCAACCCCCGAACAAGAAAAAATCCAACGCACTGCCCTCGAAAGTCGGGATGTCATGACCCAT
CTTCTCAAACTGACAAAAGAGTCCCGTGTCCCCGATCTCAAGTCCACGATGGCTGTTCCAGGTAGTGACGGCAAT
GAGAAAGCGGGTCGCGCTGCTTGGCGTCCGTCCAAGACCCGCCTCCGTTATCAGGTACTCCAGCAGCGCGAAAAC
TTCGAGCACTGGGCCGAATGGCGCGACGAAATTGTCAATCACGAACGTGAACAAGACCGTCTGGCTGCCGCTAAG
CAGGAGCGTACCATGCGTGATCGCGTCTCCAGACATGCTCACAAGGCTTCTGTCGAATTTCCCCAGGGCTCAGGC
CATGGTATGATGGGCCGTGCCTGGGAGATTCTCGGCATGCAAAAACCCCGCAAAATCGGCCCCATAAGTACTTCC
CCGGACGGTGTGGATATAGTCACGGACTAA
Gene >Pro_DTO377G3_2|g5773.t1
ATGTCTGGCCATGCCTTATCTGTAGGCACGGTGATTGAGCTGCCCGATGGACGGCTAGCAACAGTGCGTTTCATT
GGCAACACCCATTTTGCGGACGGACAGTGGATAGGCCTTGAATTAGATGAAGCCACCGGCAAAAACGATGGCGCA
GTCCAAGGCGAACGGTATTTCGATTGCTATCCAGGACACGGCATGTTTGTCCGTCCAACGGTGGTTGTTAAGATT
GTCCAGCCCGAGCCGGAGAGTAAACAAACCGCCAAACTGGCTAGCAGCGCCGCAGGTAGCAAAGCGCAGCCTAAA
CCTGGGATCTCCACTGGTATGCGCAAGCAAACTGGGCTACCTCCTACAGCAGCAAGGCGACAGAGCAGCAATGCA
GCCTCAACTCCTACTCCGGTGCCGAAGGGTGTAGCCGCTCTCCGAGTATGTCATGTCCTACAAAGGTGTTCCGTT
CCATTATGCTAACCTATGATTCTACTCAATTTAGTCCCCTACGAAGTCCCCAACGAAACAACTCGCAACGACTAC
GGGCCGCCCGTCCATCGGGAGTACTTCCCGCACCTCTACAGTGGCATCTAATCGACCACGACTAGCTCCCAGCAC
CAGAAGCCCCCCGGGTCCCTCTCCAACACAGCCAACAGCCTCTAGAGGCTCACGGCCCTCGGTATCTGGACCAGC
AGTCCGAACTTCAAGACCAGGCTCCCAAAGTGCCGTTGCTTCATCAACCCCGGGATTGACAAAGCGTCCTTCACT
ACGGCAGGTTAGCAACGCAAAAGCATCGGATGGAGGAGACGCGGCCATGAGTGGGGGATCCGGAGATCCAACCGA
GACCGAGTCGCCTGACACTGACGGGGAGGGTGCACAAGACGGACTCACCGGGCCGAAGACCTCTCGACAGTCGAT
GACTGCTTCGCGACCTGCAGCCTCGCGTCCTGGGGCCCCGCTCTCTGCATCTCAACGCCAGGGGCAGAGCAGTGC
AGTTAATCGCGAGCTCGAAGAACTTAATGCCAAGCTCAGAATAATGGAAAAGAAACGAGCCGACGACAAAGAGAA
GTTGAAGACCCTCGAGCAACTCCAGGCTGAGCGTGATAAATTTGAAACGATCATCCAGAAACTTCAAGCCAAGTA
TCAACCGCAGCAAATGGAAGTCACCGAGCTGCGCAAAAAGTTGAAAGAACTTGAGGCTCGTTCTGACGACGTGGA
ACGCATGCAGGCGGAGCATGAATCGCTCATGGAAATGGCTACTCTTGACCGCGAAATGGCAGAGGAGACAGCGGA
GGCATTCAAACATGAGTGCGCAGCGTTACGATCAAGGTTGGACGAGCTGAATTTGGAGGTGGAGGTTCTCCGAGA
GGAGAATGAAGAATACAGCCAGGAGACCACCCCCGAAGACAGAACCACTCATGGATGGCTTCAGATGGAAAGAAC
CAATGAACGTCTCCGCGAGGCGCTCATTCGTTTAAGAGATATGACTCAGCAGCAAGAGTTAGACCTCAAGTCTCA
GATCAAAGAATTGGAGGAGGATCTCGAGGAGTACGCTACCGTCAAGTCTGATTACGAGGCTGCAAAGGAGAGAAT
TTTGGTCGCTGAGACCAATGTCGATAATCTTAAGCAGCAGCTGGAGACAGCACTGGGGGCGGAAGAAATGATTGA
AGAATTAGCAGACAAAAACATGCGCTACCAGGATGAGATTAATGAGCTGAAAGCTGCCATCGAGGATTTGGAATC
TCTCAAGGAGATTAGCGATGAGATGGAGTACACCCATATTGAGACTGAGAAGCAACTTCAAGAAGAAATTGAGTA
CCGAGAGAGTGTGTTCAGCGACCAATGCCGAAAGATCACGCAACAGGACGAAGTTATCGAGGACCTTGAATATAC
ATTAACGCGTTTCAGGGATTTGGTGACGAACCTGCAATGTGACTTGGATGATATGCGCACGACAAAGCAAGTTTC
GGAGGCAGAGACCACCGAAAATGCATTGCGCCACCGCCAGATGCAAGATTTGAATATGAAACTCCAGGCCAATCA
ATCGAAGGCCCTGACCAAATCTATCGATGTTGAACTGAACCGTATGGAGTCCGAAGAAAATGCACAGCACCTTTC
GATGATAAAGCTCTATCTTCCGGAGTACTTTGAAGGGGAAAAGAATTCTATTCAGGCTTTGCTTCGATTCAAGCG
CGTCGGATTCAAAGCCAATGTTATGAGCAGCACTCTACAAGATAAGGGATCTGAGCACTCAGTAGTCTCCAACGA
GGAACTTTTCCAAGCTCATGTGGTTTTGGAATATCTTATGTGGATTTCAAACGTGTGTGATCGCTTTGTGAACTA
TATCACAGCTTGCTCGCCCGAGGAATTTGCCAATATCAAGATCGCAATGTTCGAAATGGAGCCAGTGGAGCGCAT
GTTGAACTTCTGGATCGAGCCTATGAAGAAGGACGAAGTGAATCTTGCAAAGTTTGCAGTGGAATTGCAGCGGTC
TATCGCTCTCCTCGCACACCTTGCTGAGACCCTTCTTCCTTCCAGCTTGGAGATGTTTGCCGATGAGCTGTGTAT
GCGGGCCCATTTGTCTCAATCGTACATTGAGCATTCAGCCGGTGCAATCGCACGCGTTAAGCTGATTATCAGCTC
CAAGATGGTGGCCGCGGCAGAAGGCGACGAAGAAAACCTGATTTCTCTGAATAAATTGGACACCTTCGCCTCTCA
GGCCCGCGGATACAAGGTTGCGATGGGTAAGATCAGCCGGTCTCTTGATGATCTGCGTTCTAGGTCACTTGCGCT
CCCAAAGGACGCCGAAGAACCGTTCAAGACGATAGAGAATGAAACCAAGCAACTTTCAGAGTTTGCTCGAAAGCT
CGGCGAGAACCTTGTTGTCCTCACCAGTGATGAAGGTCGCACGCACCCATTTAGCCCGGAGGAGATTCTGGACTG
TATGTCCCAGGCTGCCGTGTCCTTTGCCTCGTCCTCCGAAATCCTGGATGAAAGTAACGACCCTATATCATTGTT
ATTTACCAGATTGCAACAAGTAGGCGACCAATTTGAGGAGCTGGATACCATTTCATCAGATCTGTCTCGCACGAC
AGAGTTCGAGAGAGCTGCATTCCCCTGGGTCGCTCGCGCTGCAGAATTGAAGTCCAACAAAATGACATCCCCGGA
TGCAGACGAGGAGATTCGCCAGTTGAGAAATGAGATTCACGAAGCGTCAGCCGCACTTGGAGTCAAGGACAATAC
CCTTGAAGAACAGGGCCTAAAGATCGAGCATCTTGAATCAAGGATGCGAGAGGCGAGCAAGAAGGCTGCCATGGT
CAAAGAACTCGAAGCCAGAATCGAGGAAATCCAGAAAGCAGGGAGTGAACTCGAGAAAATAGTTGAGCAACAAAA
GAAGGAGCTTCAGACAGCCGAAGCAGAGCGAGATGAGTTCATGGCTCGTCTTGATCGAATGAAGCGCATGTCTGG
AACAGTAGGTCTGACGCCCACGGGTAACAGCGCCATCATCGCTAGTGAGGCCTCTTTAGCTGCCATGGACGAGAA
CGAGTCTCTCCGCGCTGAGGTGGAAAGCCTCCAAGCAGCTGTGCGTTTCCTGCGCGAGGAAAACCGCCGTTCGAA
CATCCTCGACCCATACTCCGTCCAGAGATCTAGTGAAATGCACGCATGGCTTGATGCGCCGCTCGTGCGTGCCAA
ACCAACCCCCGAACAAGAAAAAATCCAACGCACTGCCCTCGAAAGTCGGGATGTCATGACCCATCTTCTCAAACT
GACAAAAGAGTCCCGTGTCCCCGATCTCAAGTCCACGATGGCTGTTCCAGGTAGTGACGGCAATGAGAAAGCGGG
TCGCGCTGCTTGGCGTCCGTCCAAGACCCGCCTCCGTTATCAGGTACTCCAGCAGCGCGAAAACTTCGAGCACTG
GGCCGAATGGCGCGACGAAATTGTCAATCACGAACGTGAACAAGACCGTCTGGCTGCCGCTAAGCAGGAGCGTAC
CATGCGTGATCGCGTCTCCAGACATGCTCACAAGGCTTCTGTCGAATTTCCCCAGGGCTCAGGCCATGGTATGAT
GGGCCGTGCCTGGGAGATTCTCGGCATGCAAAAACCCCGCAAAATCGGCCCCATAAGTACTTCCCCGGACGGTGT
GGATATAGTCACGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail