Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5767.t1
Gene name
Locationscaffold_14:378592..384042
Strand+
Gene length (bp)5450
Transcript length (bp)5289
Coding sequence length (bp)5289
Protein length (aa) 1763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 2.1E-230 1028 1536
PF08766 DEK_C DEK C terminal domain 7.2E-15 1705 1759
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.3E-12 1220 1429
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 3.3E-07 790 854
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 3.0E-10 1202 1382

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 720 742 22
2 755 777 22
3 1016 1038 22
4 1408 1430 22
5 1440 1462 22
6 1469 1491 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5767.t1
MSNRYSVFSTQSTGLSVGPRPQHGAQVSTTTLLNALHSFYTAGQPYQLDSATSLVVNTWVTAATTLPDGRTGATV
DRDLAIRAWEHARRRAEDGSVVLGALHQSTPSLLEPFIAAIPVETPEVALIALSAIRPFLTAVTSFNPSYSLHSA
LAATFNLSLQGSVVGLSFALSTSGINVRKGLLDIQPETGYRAFDAFYYLLTSTSTAAEREFLDLKDPAEYTLLNR
SNTYNPPHYLPTADDAAAAEDFRASLKSIGIKGAAQRGLLSALAGLLKLGNAVGFEVDQEDLEEVCEDAGGLLGI
DLEILLHKCSTDEREVLIAGLYEALVDWVISKANEAIAADIQIALENDSSNGGGAAQWSTDDTVNLTVIDIPRPA
LGKAIMMRGIFDDALGLNAEMKDDGIPLPPIGASIISEMNSAVAQVEPDLNIMTGLAGREREHDLDKRQGVLEKV
GVELEIDAFLRRVLFPNDTEGISVGKRGRFDLANTLNSSRVWYHLSIHPTDDMPEQLVSLGPTAWSAGAVSRQLR
DWRLPEWANRRLKQLDFTADFDVEEFVSRYARLGCTEGQDGVENWIIERGWSNGDAVVGEQRVWMREGAWWEAES
MLDLKPEETQVNPFMYGPALYETAFTPDGTPIHENSNLLSMPPSGAIAPSVIDGAKSIAPSAPFANAVNTGDYGL
GRKGDDKKGDIAYYDEYGRYVGEFDPEFGDPKHIEKKTITLGRRLWTGFVWALTFWIPSFVLRYIGRMKRPDVRL
AWREKLVLVFLILLFNAIVCFYIIAFGDLLCPNKDKVWNKKEVSWHTTDNNFYVGIHGRVYDISKFWRTQHSDIT
GETTSSTNMEQFGGEILDAYFPPPLNRYCSSFVTSDTLALQHNDTSAIALSTAEHKSGAQATSTTSALHKSTWYE
KKFLPKIGTYYKGDLVWTRDTIKKQADADSRYWVIKDQKVYDLTDYFYTLSTMNNLDTYDWLPSTLTALFKDNMG
EDVTDKWEDTTDFKNAQTCLDFVFYVGKVDFRESARCTVNNWILLTFTILICAVILVKFLAALQLGSKRRPTPQD
KFVICMVPAYTEGENDLRKGLDSLTALQYDNKRKLIFVICDGMIVGGGNDRPTPKIVLDILGVDPKMDPPALPCK
SLGQGSEQLNYGKVYSGLYEYEGNVVPYIVVVKVGKESEQRKSKPGNRGKRDTQVLLMQFLNRVHHRSPMSPLEL
EMFHQINNVIGVDPELYEYCLMVDADTTVKEDSLNRLVAACAADAKIAGICGETSLQNEERSWWTMIQVYEYYIS
HHLAKAFESLFGSVTCLPGCFTMYRLRTADKGRPLIISDKVIHDYADNDVDTLHKKNLLSLGEDRYLTTIMTKHF
PAMSYKFIPDAYASTAAPDTWSVLMSQRRRWINSTIHNLVELAALEDLCGFCCFSMRFVVLVDLVGTLILPATCV
YLTYLIYRVASNTGPFPMISIIMLAGVYGLQAIIFIVKRQWQHIGWMIIYLLAYPIYNFVLPLYAFWKQDDFTWG
TTRIVIGEKGDKRVIAVEDEPFDPRSIPLQRWDDYAMANNLPGRRGEVSASQEKVYATGRYDEMAMEMDDMHSQY
SSVKPASTILTGFPGQGRNHPYMPPQSPAPFVGGNVPGNRNSHMSNFSRYTDLPQMSPRMGGHSAQASRHMSMGG
LSAYQDNPMASSRHSVGMMQSSENLLGNAGSRSPLPQYPSRPASTAFDFRSASGPDEGAITEAIRGCLAEVDLDT
VTKKQVRVLVEHRLQTSLTGDKRAFLDRQIDQELANM*
Coding >Pro_DTO377G3_2|g5767.t1
ATGTCGAACCGTTATTCGGTCTTCTCCACGCAGTCGACAGGTCTCTCAGTCGGACCCAGACCCCAACATGGAGCT
CAGGTCTCAACAACAACGTTACTGAATGCCCTCCATTCGTTTTATACCGCGGGGCAACCATATCAACTAGACTCC
GCCACGAGTTTGGTTGTAAATACATGGGTGACCGCAGCAACCACTTTACCCGATGGGCGAACGGGTGCCACCGTC
GACCGTGATCTGGCTATCAGAGCTTGGGAACATGCTCGACGCCGAGCTGAGGATGGCTCCGTTGTTCTAGGCGCC
CTCCATCAATCCACGCCCTCGTTGCTCGAACCCTTCATCGCAGCGATCCCAGTGGAAACACCCGAGGTAGCTCTG
ATCGCCCTATCCGCTATACGACCTTTCCTTACTGCAGTCACCTCGTTCAACCCCTCCTATTCTCTCCATTCGGCA
TTGGCCGCCACTTTCAACTTATCTTTGCAAGGATCTGTCGTCGGCCTCTCCTTCGCCTTGTCCACTTCCGGTATC
AATGTGCGCAAGGGTCTTTTAGACATCCAGCCCGAGACCGGCTACCGTGCATTTGATGCCTTCTATTATCTCCTA
ACATCGACATCGACAGCTGCGGAGCGGGAATTTTTGGACTTGAAAGACCCCGCCGAATATACCTTGCTCAACCGA
TCAAACACATATAATCCTCCACACTATCTACCCACAGCCGATGATGCTGCCGCTGCAGAAGACTTCCGTGCTTCT
TTGAAATCCATTGGTATCAAAGGTGCTGCCCAGCGAGGCTTGCTATCGGCCCTTGCTGGTCTTCTTAAGCTCGGC
AACGCAGTCGGGTTCGAGGTGGACCAAGAAGACCTGGAAGAGGTCTGTGAGGATGCTGGAGGTCTCCTGGGAATT
GATCTAGAAATCCTTCTTCATAAATGTTCCACTGATGAGCGAGAGGTTTTGATCGCCGGACTCTACGAAGCTCTG
GTCGATTGGGTCATCAGCAAAGCAAATGAAGCTATCGCAGCCGACATTCAGATTGCATTGGAAAACGATTCTAGC
AACGGGGGTGGTGCAGCACAATGGTCAACGGACGATACAGTCAACCTGACTGTAATCGATATTCCACGACCGGCT
CTCGGTAAAGCGATCATGATGAGAGGCATCTTCGATGATGCTCTTGGTCTCAATGCTGAAATGAAGGACGATGGA
ATTCCCCTTCCGCCTATTGGAGCTTCCATCATCAGTGAAATGAACTCTGCAGTAGCTCAAGTCGAACCAGATCTC
AATATCATGACAGGCCTTGCCGGGCGGGAACGCGAACATGATCTCGACAAGCGGCAGGGGGTATTGGAAAAGGTT
GGTGTTGAACTTGAGATTGACGCTTTTCTCAGACGCGTTCTGTTCCCCAATGATACCGAAGGTATCTCCGTGGGA
AAGCGTGGCCGATTCGATCTTGCCAACACGCTCAACAGCAGCCGTGTCTGGTACCACCTCTCCATCCATCCGACT
GATGATATGCCGGAGCAGCTCGTGTCATTGGGACCTACAGCGTGGTCTGCTGGTGCAGTCTCCCGCCAACTGCGG
GACTGGCGACTGCCGGAATGGGCCAATCGTCGTTTGAAGCAACTCGATTTCACCGCCGATTTCGACGTGGAAGAG
TTTGTCAGTCGATATGCGCGACTTGGTTGCACCGAAGGCCAGGACGGTGTTGAGAACTGGATCATTGAGAGAGGC
TGGAGCAACGGCGACGCCGTCGTCGGTGAACAGCGCGTATGGATGCGCGAGGGGGCATGGTGGGAAGCGGAAAGT
ATGCTGGATCTCAAGCCAGAGGAAACTCAGGTGAATCCATTCATGTACGGCCCTGCGTTGTATGAGACCGCCTTC
ACCCCAGATGGCACTCCCATCCATGAGAATTCCAATCTTCTTAGCATGCCACCTAGCGGCGCCATCGCCCCCAGT
GTGATTGACGGTGCCAAGTCCATCGCCCCCAGTGCGCCATTCGCCAACGCTGTTAATACCGGTGACTACGGTTTG
GGCCGGAAAGGTGACGACAAAAAAGGAGACATTGCGTACTACGACGAGTATGGCCGGTACGTCGGCGAATTCGAC
CCTGAGTTTGGTGATCCAAAGCACATCGAGAAGAAGACCATCACCTTGGGCCGCCGGCTCTGGACTGGTTTTGTC
TGGGCGCTGACTTTCTGGATTCCTTCCTTCGTGCTCCGATACATTGGCCGCATGAAACGCCCGGATGTCCGCCTG
GCCTGGCGAGAAAAGCTCGTCCTTGTGTTTTTGATTCTGCTTTTCAATGCAATTGTTTGCTTCTATATCATTGCG
TTTGGTGACCTTCTCTGTCCCAACAAGGACAAAGTCTGGAATAAGAAGGAAGTCAGCTGGCACACAACTGACAAT
AACTTTTACGTCGGCATCCACGGCCGTGTCTACGACATCAGCAAGTTCTGGCGCACACAACACAGTGACATTACT
GGAGAAACAACATCCTCGACGAACATGGAACAATTTGGAGGAGAGATTTTAGATGCCTACTTTCCCCCTCCCCTC
AATCGTTATTGTTCCTCATTTGTTACATCCGATACACTCGCTTTGCAGCACAACGACACATCCGCCATCGCCCTT
TCTACGGCCGAGCACAAATCGGGGGCACAAGCAACAAGCACCACCTCAGCACTCCACAAGTCTACCTGGTATGAA
AAGAAATTCTTGCCAAAGATTGGTACATACTACAAGGGTGACCTGGTTTGGACAAGGGATACCATCAAGAAGCAG
GCCGACGCTGATTCTCGCTACTGGGTTATCAAGGATCAAAAGGTGTATGACTTGACAGATTACTTCTATACACTG
AGCACGATGAACAATCTCGACACATACGATTGGCTACCCTCGACTCTGACTGCTCTCTTCAAGGACAACATGGGC
GAAGACGTCACTGACAAATGGGAGGACACGACAGATTTCAAAAATGCTCAGACATGTCTCGACTTTGTCTTCTAT
GTCGGCAAAGTTGATTTCCGTGAAAGTGCACGATGCACTGTCAATAATTGGATCCTGCTCACCTTTACCATTCTT
ATCTGCGCTGTCATTCTGGTCAAATTCCTGGCAGCTCTGCAGCTGGGGTCCAAACGTCGGCCCACGCCTCAGGAC
AAATTTGTCATCTGCATGGTCCCCGCATACACTGAGGGCGAGAACGATCTGAGGAAAGGTCTTGATTCTCTGACT
GCCTTGCAGTACGACAACAAGAGAAAGCTGATCTTTGTCATCTGTGATGGTATGATTGTTGGTGGCGGAAATGAC
CGCCCCACCCCAAAGATCGTTCTGGACATTCTCGGGGTTGATCCTAAGATGGACCCACCGGCACTGCCATGCAAA
TCTCTCGGTCAGGGAAGTGAGCAGCTGAACTACGGCAAGGTTTACTCTGGACTCTATGAGTACGAAGGCAATGTC
GTGCCCTACATTGTGGTCGTCAAGGTTGGCAAGGAATCCGAGCAGCGCAAGTCCAAACCCGGCAATCGTGGCAAG
CGAGACACGCAGGTCCTTCTCATGCAGTTCTTGAACCGTGTTCACCATCGCTCACCTATGTCCCCCCTTGAACTG
GAAATGTTCCACCAAATCAACAACGTCATCGGTGTGGATCCCGAGCTATATGAATACTGTCTCATGGTCGACGCA
GATACCACCGTCAAGGAGGATTCTCTGAATCGCTTGGTCGCAGCATGTGCAGCAGATGCCAAGATCGCTGGCATT
TGCGGCGAGACTAGTCTTCAGAACGAGGAACGTAGTTGGTGGACCATGATTCAGGTTTACGAATACTATATCTCG
CATCACCTGGCCAAGGCATTTGAGTCGCTCTTCGGCAGTGTTACTTGTCTTCCTGGATGTTTCACCATGTACCGC
CTTCGAACTGCGGACAAAGGACGTCCTCTTATTATCTCGGACAAAGTCATTCACGATTACGCTGACAATGATGTT
GACACCCTCCACAAGAAGAACCTCTTATCTCTTGGCGAGGATCGGTACCTAACAACCATCATGACCAAGCACTTC
CCAGCCATGTCGTACAAGTTTATTCCAGATGCCTACGCGAGCACAGCCGCCCCCGATACCTGGAGTGTCCTTATG
TCGCAGAGACGTCGTTGGATCAACTCCACAATCCACAACCTGGTGGAACTGGCAGCTCTGGAAGATCTCTGCGGT
TTCTGCTGTTTCAGTATGCGTTTCGTCGTTCTCGTCGATCTGGTGGGAACTCTCATTCTTCCTGCGACCTGCGTG
TACCTCACCTACCTGATCTACCGAGTTGCCAGCAACACGGGTCCCTTCCCTATGATCTCGATTATCATGCTGGCT
GGTGTATATGGTCTGCAAGCGATCATCTTCATTGTCAAACGGCAGTGGCAACACATCGGATGGATGATCATCTAC
CTTCTTGCGTACCCGATCTACAATTTCGTCTTGCCGTTGTATGCCTTCTGGAAACAGGACGATTTCACATGGGGT
ACCACCCGTATTGTCATCGGCGAGAAGGGCGACAAGCGTGTCATCGCCGTGGAAGATGAGCCCTTCGATCCACGC
AGCATCCCTCTCCAGCGCTGGGATGACTACGCCATGGCCAATAACCTCCCCGGCCGCCGCGGCGAGGTCAGTGCC
AGCCAGGAGAAGGTCTACGCCACCGGCCGGTATGACGAAATGGCTATGGAGATGGATGACATGCACTCGCAGTAC
TCATCCGTCAAGCCAGCCTCCACCATTCTCACCGGGTTCCCAGGCCAGGGCCGCAACCACCCCTACATGCCCCCA
CAGTCTCCCGCACCCTTCGTCGGCGGCAACGTCCCCGGAAACCGCAACTCGCACATGTCGAACTTCTCCCGCTAC
ACTGATCTGCCGCAGATGAGCCCTCGCATGGGCGGCCACTCTGCCCAGGCTTCTCGGCACATGTCCATGGGTGGC
CTCAGTGCCTACCAAGACAACCCGATGGCCTCGAGCAGACACAGCGTCGGCATGATGCAGAGTAGCGAGAACCTC
CTCGGCAATGCTGGCTCGCGCAGCCCCCTGCCCCAGTACCCCTCTCGACCCGCCAGCACCGCCTTTGATTTCCGT
TCTGCCAGTGGGCCCGATGAGGGTGCTATCACCGAGGCAATCCGCGGCTGTTTGGCCGAGGTTGATCTAGACACT
GTCACCAAAAAACAGGTCCGCGTTCTTGTCGAACACCGCCTGCAAACCTCGCTCACGGGCGACAAGCGAGCCTTC
CTGGACCGACAGATCGACCAGGAATTGGCTAACATGTAA
Transcript >Pro_DTO377G3_2|g5767.t1
ATGTCGAACCGTTATTCGGTCTTCTCCACGCAGTCGACAGGTCTCTCAGTCGGACCCAGACCCCAACATGGAGCT
CAGGTCTCAACAACAACGTTACTGAATGCCCTCCATTCGTTTTATACCGCGGGGCAACCATATCAACTAGACTCC
GCCACGAGTTTGGTTGTAAATACATGGGTGACCGCAGCAACCACTTTACCCGATGGGCGAACGGGTGCCACCGTC
GACCGTGATCTGGCTATCAGAGCTTGGGAACATGCTCGACGCCGAGCTGAGGATGGCTCCGTTGTTCTAGGCGCC
CTCCATCAATCCACGCCCTCGTTGCTCGAACCCTTCATCGCAGCGATCCCAGTGGAAACACCCGAGGTAGCTCTG
ATCGCCCTATCCGCTATACGACCTTTCCTTACTGCAGTCACCTCGTTCAACCCCTCCTATTCTCTCCATTCGGCA
TTGGCCGCCACTTTCAACTTATCTTTGCAAGGATCTGTCGTCGGCCTCTCCTTCGCCTTGTCCACTTCCGGTATC
AATGTGCGCAAGGGTCTTTTAGACATCCAGCCCGAGACCGGCTACCGTGCATTTGATGCCTTCTATTATCTCCTA
ACATCGACATCGACAGCTGCGGAGCGGGAATTTTTGGACTTGAAAGACCCCGCCGAATATACCTTGCTCAACCGA
TCAAACACATATAATCCTCCACACTATCTACCCACAGCCGATGATGCTGCCGCTGCAGAAGACTTCCGTGCTTCT
TTGAAATCCATTGGTATCAAAGGTGCTGCCCAGCGAGGCTTGCTATCGGCCCTTGCTGGTCTTCTTAAGCTCGGC
AACGCAGTCGGGTTCGAGGTGGACCAAGAAGACCTGGAAGAGGTCTGTGAGGATGCTGGAGGTCTCCTGGGAATT
GATCTAGAAATCCTTCTTCATAAATGTTCCACTGATGAGCGAGAGGTTTTGATCGCCGGACTCTACGAAGCTCTG
GTCGATTGGGTCATCAGCAAAGCAAATGAAGCTATCGCAGCCGACATTCAGATTGCATTGGAAAACGATTCTAGC
AACGGGGGTGGTGCAGCACAATGGTCAACGGACGATACAGTCAACCTGACTGTAATCGATATTCCACGACCGGCT
CTCGGTAAAGCGATCATGATGAGAGGCATCTTCGATGATGCTCTTGGTCTCAATGCTGAAATGAAGGACGATGGA
ATTCCCCTTCCGCCTATTGGAGCTTCCATCATCAGTGAAATGAACTCTGCAGTAGCTCAAGTCGAACCAGATCTC
AATATCATGACAGGCCTTGCCGGGCGGGAACGCGAACATGATCTCGACAAGCGGCAGGGGGTATTGGAAAAGGTT
GGTGTTGAACTTGAGATTGACGCTTTTCTCAGACGCGTTCTGTTCCCCAATGATACCGAAGGTATCTCCGTGGGA
AAGCGTGGCCGATTCGATCTTGCCAACACGCTCAACAGCAGCCGTGTCTGGTACCACCTCTCCATCCATCCGACT
GATGATATGCCGGAGCAGCTCGTGTCATTGGGACCTACAGCGTGGTCTGCTGGTGCAGTCTCCCGCCAACTGCGG
GACTGGCGACTGCCGGAATGGGCCAATCGTCGTTTGAAGCAACTCGATTTCACCGCCGATTTCGACGTGGAAGAG
TTTGTCAGTCGATATGCGCGACTTGGTTGCACCGAAGGCCAGGACGGTGTTGAGAACTGGATCATTGAGAGAGGC
TGGAGCAACGGCGACGCCGTCGTCGGTGAACAGCGCGTATGGATGCGCGAGGGGGCATGGTGGGAAGCGGAAAGT
ATGCTGGATCTCAAGCCAGAGGAAACTCAGGTGAATCCATTCATGTACGGCCCTGCGTTGTATGAGACCGCCTTC
ACCCCAGATGGCACTCCCATCCATGAGAATTCCAATCTTCTTAGCATGCCACCTAGCGGCGCCATCGCCCCCAGT
GTGATTGACGGTGCCAAGTCCATCGCCCCCAGTGCGCCATTCGCCAACGCTGTTAATACCGGTGACTACGGTTTG
GGCCGGAAAGGTGACGACAAAAAAGGAGACATTGCGTACTACGACGAGTATGGCCGGTACGTCGGCGAATTCGAC
CCTGAGTTTGGTGATCCAAAGCACATCGAGAAGAAGACCATCACCTTGGGCCGCCGGCTCTGGACTGGTTTTGTC
TGGGCGCTGACTTTCTGGATTCCTTCCTTCGTGCTCCGATACATTGGCCGCATGAAACGCCCGGATGTCCGCCTG
GCCTGGCGAGAAAAGCTCGTCCTTGTGTTTTTGATTCTGCTTTTCAATGCAATTGTTTGCTTCTATATCATTGCG
TTTGGTGACCTTCTCTGTCCCAACAAGGACAAAGTCTGGAATAAGAAGGAAGTCAGCTGGCACACAACTGACAAT
AACTTTTACGTCGGCATCCACGGCCGTGTCTACGACATCAGCAAGTTCTGGCGCACACAACACAGTGACATTACT
GGAGAAACAACATCCTCGACGAACATGGAACAATTTGGAGGAGAGATTTTAGATGCCTACTTTCCCCCTCCCCTC
AATCGTTATTGTTCCTCATTTGTTACATCCGATACACTCGCTTTGCAGCACAACGACACATCCGCCATCGCCCTT
TCTACGGCCGAGCACAAATCGGGGGCACAAGCAACAAGCACCACCTCAGCACTCCACAAGTCTACCTGGTATGAA
AAGAAATTCTTGCCAAAGATTGGTACATACTACAAGGGTGACCTGGTTTGGACAAGGGATACCATCAAGAAGCAG
GCCGACGCTGATTCTCGCTACTGGGTTATCAAGGATCAAAAGGTGTATGACTTGACAGATTACTTCTATACACTG
AGCACGATGAACAATCTCGACACATACGATTGGCTACCCTCGACTCTGACTGCTCTCTTCAAGGACAACATGGGC
GAAGACGTCACTGACAAATGGGAGGACACGACAGATTTCAAAAATGCTCAGACATGTCTCGACTTTGTCTTCTAT
GTCGGCAAAGTTGATTTCCGTGAAAGTGCACGATGCACTGTCAATAATTGGATCCTGCTCACCTTTACCATTCTT
ATCTGCGCTGTCATTCTGGTCAAATTCCTGGCAGCTCTGCAGCTGGGGTCCAAACGTCGGCCCACGCCTCAGGAC
AAATTTGTCATCTGCATGGTCCCCGCATACACTGAGGGCGAGAACGATCTGAGGAAAGGTCTTGATTCTCTGACT
GCCTTGCAGTACGACAACAAGAGAAAGCTGATCTTTGTCATCTGTGATGGTATGATTGTTGGTGGCGGAAATGAC
CGCCCCACCCCAAAGATCGTTCTGGACATTCTCGGGGTTGATCCTAAGATGGACCCACCGGCACTGCCATGCAAA
TCTCTCGGTCAGGGAAGTGAGCAGCTGAACTACGGCAAGGTTTACTCTGGACTCTATGAGTACGAAGGCAATGTC
GTGCCCTACATTGTGGTCGTCAAGGTTGGCAAGGAATCCGAGCAGCGCAAGTCCAAACCCGGCAATCGTGGCAAG
CGAGACACGCAGGTCCTTCTCATGCAGTTCTTGAACCGTGTTCACCATCGCTCACCTATGTCCCCCCTTGAACTG
GAAATGTTCCACCAAATCAACAACGTCATCGGTGTGGATCCCGAGCTATATGAATACTGTCTCATGGTCGACGCA
GATACCACCGTCAAGGAGGATTCTCTGAATCGCTTGGTCGCAGCATGTGCAGCAGATGCCAAGATCGCTGGCATT
TGCGGCGAGACTAGTCTTCAGAACGAGGAACGTAGTTGGTGGACCATGATTCAGGTTTACGAATACTATATCTCG
CATCACCTGGCCAAGGCATTTGAGTCGCTCTTCGGCAGTGTTACTTGTCTTCCTGGATGTTTCACCATGTACCGC
CTTCGAACTGCGGACAAAGGACGTCCTCTTATTATCTCGGACAAAGTCATTCACGATTACGCTGACAATGATGTT
GACACCCTCCACAAGAAGAACCTCTTATCTCTTGGCGAGGATCGGTACCTAACAACCATCATGACCAAGCACTTC
CCAGCCATGTCGTACAAGTTTATTCCAGATGCCTACGCGAGCACAGCCGCCCCCGATACCTGGAGTGTCCTTATG
TCGCAGAGACGTCGTTGGATCAACTCCACAATCCACAACCTGGTGGAACTGGCAGCTCTGGAAGATCTCTGCGGT
TTCTGCTGTTTCAGTATGCGTTTCGTCGTTCTCGTCGATCTGGTGGGAACTCTCATTCTTCCTGCGACCTGCGTG
TACCTCACCTACCTGATCTACCGAGTTGCCAGCAACACGGGTCCCTTCCCTATGATCTCGATTATCATGCTGGCT
GGTGTATATGGTCTGCAAGCGATCATCTTCATTGTCAAACGGCAGTGGCAACACATCGGATGGATGATCATCTAC
CTTCTTGCGTACCCGATCTACAATTTCGTCTTGCCGTTGTATGCCTTCTGGAAACAGGACGATTTCACATGGGGT
ACCACCCGTATTGTCATCGGCGAGAAGGGCGACAAGCGTGTCATCGCCGTGGAAGATGAGCCCTTCGATCCACGC
AGCATCCCTCTCCAGCGCTGGGATGACTACGCCATGGCCAATAACCTCCCCGGCCGCCGCGGCGAGGTCAGTGCC
AGCCAGGAGAAGGTCTACGCCACCGGCCGGTATGACGAAATGGCTATGGAGATGGATGACATGCACTCGCAGTAC
TCATCCGTCAAGCCAGCCTCCACCATTCTCACCGGGTTCCCAGGCCAGGGCCGCAACCACCCCTACATGCCCCCA
CAGTCTCCCGCACCCTTCGTCGGCGGCAACGTCCCCGGAAACCGCAACTCGCACATGTCGAACTTCTCCCGCTAC
ACTGATCTGCCGCAGATGAGCCCTCGCATGGGCGGCCACTCTGCCCAGGCTTCTCGGCACATGTCCATGGGTGGC
CTCAGTGCCTACCAAGACAACCCGATGGCCTCGAGCAGACACAGCGTCGGCATGATGCAGAGTAGCGAGAACCTC
CTCGGCAATGCTGGCTCGCGCAGCCCCCTGCCCCAGTACCCCTCTCGACCCGCCAGCACCGCCTTTGATTTCCGT
TCTGCCAGTGGGCCCGATGAGGGTGCTATCACCGAGGCAATCCGCGGCTGTTTGGCCGAGGTTGATCTAGACACT
GTCACCAAAAAACAGGTCCGCGTTCTTGTCGAACACCGCCTGCAAACCTCGCTCACGGGCGACAAGCGAGCCTTC
CTGGACCGACAGATCGACCAGGAATTGGCTAACATGTAA
Gene >Pro_DTO377G3_2|g5767.t1
ATGTCGAACCGTTATTCGGTCTTCTCCACGCAGTCGACAGGTCTCTCAGTCGGACCCAGACCCCAACATGGAGCT
CAGGTCTCAACAACAACGTTACTGAATGCCCTCCATTCGTTTTATACCGCGGGGCAACCATATCAACTAGACTCC
GCCACGAGTTTGGTTGTAAATACATGGGTGACCGCAGCAACCACTTTACCCGATGGGCGAACGGGTGCCACCGTC
GACCGTGATCTGGCTATCAGAGCTTGGGAACATGCTCGACGCCGAGCTGAGGATGGCTCCGTTGTTCTAGGGTAT
GTTTAACACTGCATCGATCCGAAGACCATACGTGCTAATATCGAATAGCGCCCTCCATCAATCCACGCCCTCGTT
GCTCGAACCCTTCATCGCAGCGATCCCAGTGGAAACACCCGAGGTAGCTCTGATCGCCCTATCCGCTATACGACC
TTTCCTTACTGCAGTCACCTCGTTCAACCCCTCCTATTCTCTCCATTCGGCATTGGCCGCCACTTTCAACTTATC
TTTGCAAGGATCTGTCGTCGGCCTCTCCTTCGCCTTGTCCACTTCCGGTATCAATGTGCGCAAGGGTCTTTTAGA
CATCCAGCCCGAGACCGGCTACCGTGCATTTGATGCCTTCTATTATCTCCTAACATCGACATCGACAGCTGCGGA
GCGGGAATTTTTGGACTTGAAAGACCCCGCCGAATATACCTTGCTCAACCGATCAAACACATATAATCCTCCACA
CTATCTACCCACAGCCGATGATGCTGCCGCTGCAGAAGACTTCCGTGCTTCTTTGAAATCCATTGGTATCAAAGG
TGCTGCCCAGCGAGGCTTGCTATCGGCCCTTGCTGGTCTTCTTAAGCTCGGCAACGCAGTCGGGTTCGAGGTGGA
CCAAGAAGACCTGGAAGAGGTCTGTGAGGATGCTGGAGGTCTCCTGGGAATTGATCTAGAAATCCTTCTTCATAA
ATGTTCCACTGATGAGCGAGAGGTTTTGATCGCCGGACTCTACGAAGCTCTGGTCGATTGGGTCATCAGCAAAGC
AAATGAAGCTATCGCAGCCGACATTCAGATTGCATTGGAAAACGATTCTAGCAACGGGGGTGGTGCAGCACAATG
GTCAACGGACGATACAGTCAACCTGACTGTAATCGATATTCCACGACCGGCTCTCGGTAAAGCGATCATGATGAG
AGGCATCTTCGATGATGCTCTTGGTCTCAATGCTGAAATGAAGGACGATGGAATTCCCCTTCCGCCTATTGGAGC
TTCCATCATCAGTGAAATGAACTCTGCAGTAGCTCAAGTCGAACCAGATCTCAATATCATGACAGGCCTTGCCGG
GCGGGAACGCGAACATGATCTCGACAAGCGGCAGGGGGTATTGGAAAAGGTTGGTGTTGAACTTGAGATTGACGC
TTTTCTCAGACGCGTTCTGTTCCCCAATGATACCGAAGGTATCTCCGTGGGAAAGCGTGGCCGATTCGATCTTGC
CAACACGCTCAACAGCAGCCGTGTCTGGTACCACCTCTCCATCCATCCGACTGATGATATGCCGGAGCAGCTCGT
GTCATTGGGACCTACAGCGTGGTCTGCTGGTGCAGTCTCCCGCCAACTGCGGGACTGGCGACTGCCGGAATGGGC
CAATCGTCGTTTGAAGCAACTCGATTTCACCGCCGATTTCGACGTGGAAGAGTTTGTCAGTCGATATGCGCGACT
TGGTTGCACCGAAGGCCAGGACGGTGTTGAGAACTGGATCATTGAGAGAGGCTGGAGCAACGGCGACGCCGTCGT
CGGTGAACAGCGCGTATGGATGCGCGAGGGGGCATGGTGGGAAGCGGAAAGTATGCTGGATCTCAAGCCAGAGGA
AACTCAGGTGAATCCATTCATGTACGGCCCTGCGTTGTATGAGACCGCCTTCACCCCAGATGGCACTCCCATCCA
TGAGAATTCCAATCTTCTTAGCATGCCACCTAGCGGCGCCATCGCCCCCAGTGTGATTGACGGTGCCAAGTCCAT
CGCCCCCAGTGCGCCATTCGCCAACGCTGTTAATACCGGTGACTACGGTTTGGGCCGGAAAGGTGACGACAAAAA
AGGAGACATTGCGTACTACGACGAGTATGGCCGGTACGTCGGCGAATTCGACCCTGAGTTTGGTGATCCAAAGCA
CATCGAGAAGAAGACCATCACCTTGGGCCGCCGGCTCTGGACTGGTTTTGTCTGGGCGCTGACTTTCTGGATTCC
TTCCTTCGTGCTCCGATACATTGGCCGCATGAAACGCCCGGATGTCCGCCTGGCCTGGCGAGAAAAGCTCGTCCT
TGTGTTTTTGATTCTGCTTTTCAATGCAATTGTTTGCTTCTATATCATTGCGTTTGGTGACCTTCTCTGTCCCAA
CAAGGACAAAGTCTGGAATAAGAAGGAAGTCAGCTGGCACACAACTGACAATAACTTTTACGTCGGCATCCACGG
CCGTGTCTACGACATCAGCAAGTTCTGGCGCACACAACACAGTGACATTACTGGAGAAACAACATCCTCGACGAA
CATGGAACAATTTGGAGGAGAGATTTTAGATGCCTACTTTCCCCCTCCCCTCAATCGTTATTGTTCCTCATTTGT
TACATCCGATACACTCGCTTTGCAGCACAACGACACATCCGCCATCGCCCTTTCTACGGCCGAGCACAAATCGGG
GGCACAAGCAACAAGCACCACCTCAGCACTCCACAAGTCTACCTGGTATGAAAAGAAATTCTTGCCAAAGATTGG
TACATACTACAAGGGTGACCTGGTTTGGACAAGGGATACCATCAAGAAGCAGGCCGACGCTGATTCTCGCTACTG
GGTTATCAAGGATCAAAAGGTGTATGACTTGACAGATTACTTCTATACACTGAGCACGATGAACAATCTCGACAC
ATACGATTGGCTACCCTCGACTCTGACTGCTCTCTTCAAGGACAACATGGGCGAAGACGTCACTGACAAATGGGA
GGACACGACAGATTTCAAAAATGCTCAGACATGTCTCGACTTTGTCTTCTATGTCGGCAAAGTTGATTTCCGTGA
AAGTGCACGATGCACTGTCAATAATTGGATCCTGCTCACCTTTACCATTCTTATCTGCGCTGTCATTCTGGTCAA
ATTCCTGGCAGCTCTGCAGCTGGGGTCCAAACGTCGGCCCACGCCTCAGGACAAATTTGTCATCTGCATGGTCCC
CGCATACACTGAGGGCGAGAACGATCTGAGGAAAGGTCTTGATTCTCTGACTGCCTTGCAGTACGACAACAAGAG
AAAGCTGATCTTTGTCATCTGTGATGGTATGATTGTTGGTGGCGGAAATGACCGCCCCACCCCAAAGATCGTTCT
GGACATTCTCGGGGTTGATCCTAAGATGGACCCACCGGCACTGCCATGCAAATCTCTCGGTCAGGGAAGTGAGCA
GCTGAACTACGGCAAGGTTTACTCTGGACTCTATGAGTACGAAGGCAATGTCGTGCCCTACATTGTGGTCGTCAA
GGTTGGCAAGGAATCCGAGCAGCGCAAGTCCAAACCCGGCAATCGTGGCAAGCGAGACACGCAGGTCCTTCTCAT
GCAGTTCTTGAACCGTGTTCACCATCGCTCACCTATGTCCCCCCTTGAACTGGAAATGTTCCACCAAATCAACAA
CGTCATCGGTGTGGATCCCGAGCTATATGAATACTGTCTCATGGTCGACGCAGATACCACCGTCAAGGAGGATTC
TCTGAATCGCTTGGTCGCAGCATGTGCAGCAGATGCCAAGATCGCTGGCATTTGCGGCGAGACTAGTCTTCAGAA
CGAGGAACGTAGTTGGTGGACCATGATTCAGGTTTACGAATACTATATCTCGCATCACCTGGCCAAGGCATTTGA
GTCGCTCTTCGGCAGTGTTACTTGTCTTCCTGGATGGTACGTTCCTATATGCTTTCTCGGAAATAAGTGATACTA
ACAATACCTAGTTTCACCATGTACCGCCTTCGAACTGCGGACAAAGGACGTCCTCTTATTATCTCGGACAAAGTC
ATTCACGATTACGCTGACAATGATGTTGACACCCTCCACAAGAAGAACCTCTTATCTCTTGGCGAGGATCGGTAC
CTAACAACCATCATGACCAAGCACTTCCCAGCCATGTCGTACAAGTTTATTCCAGATGCCTACGCGAGCACAGCC
GCCCCCGATACCTGGAGTGTCCTTATGTCGCAGAGACGTCGTTGGATCAACTCCACAATCCACAACCTGGTGGAA
CTGGCAGCTCTGGAAGATCTCTGCGGTTTCTGCTGTTTCAGTATGCGTTTCGTCGTTCTCGTCGATCTGGTGGGA
ACTCTCATTCTTCCTGCGACCTGCGTGTACCTCACCTACCTGATCTACCGAGTTGCCAGCAACACGGGTCCCTTC
CCTATGATCTCGATTATCATGCTGGCTGGTGTATATGGTCTGCAAGCGATCATCTTCATTGTCAAACGGCAGTGG
CAACACATCGGATGGATGATCATCTACCTTCTTGCGTACCCGATCTACAATTTCGTCTTGCCGTTGTATGCCTTC
TGGAAACAGGACGATTTCACATGGGGTACCACCCGTATTGTCATCGGCGAGAAGGGCGACAAGCGTGTCATCGCC
GTGGAAGATGAGCCCTTCGATCCACGCAGCATCCCTCTCCAGCGCTGGGATGACTACGCCATGGCCAATAACCTC
CCCGGCCGCCGCGGCGAGGTCAGTGCCAGCCAGGAGAAGGTCTACGCCACCGGCCGGTATGACGAAATGGCTATG
GAGATGGATGACATGCACTCGCAGTACTCATCCGTCAAGCCAGCCTCCACCATTCTCACCGGGTTCCCAGGCCAG
GGCCGCAACCACCCCTACATGCCCCCACAGTCTCCCGCACCCTTCGTCGGCGGCAACGTCCCCGGAAACCGCAAC
TCGCACATGTCGAACTTCTCCCGCTACACTGATCTGCCGCAGATGAGCCCTCGCATGGGCGGCCACTCTGCCCAG
GCTTCTCGGCACATGTCCATGGGTGGCCTCAGTGCCTACCAAGACAACCCGATGGCCTCGAGCAGACACAGCGTC
GGCATGATGCAGAGTAGCGAGAACCTCCTCGGCAATGCTGGCTCGCGCAGCCCCCTGCCCCAGTACCCCTCTCGA
CCCGCCAGCACCGCCTTTGATTTCCGTTCTGCCAGTGGGCCCGATGAGGGTGCTATCACCGAGGCAATCCGCGGC
TGTTTGGCCGAGGTTGATCTAGACACTGTCACCAAAAAACAGGGTAAGTTCCTACCTTAATTTCTATGATAATCA
TACAGTTCGCTAACCATGACCCAACAGTCCGCGTTCTTGTCGAACACCGCCTGCAAACCTCGCTCACGGGCGACA
AGCGAGCCTTCCTGGACCGACAGATCGACCAGGAATTGGCTAACATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail