Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5760.t1
Gene name
Locationscaffold_14:357490..359090
Strand+
Gene length (bp)1600
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03348 Serinc Serine incorporator (Serinc) 1.1E-173 23 474

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 95 117 22
4 137 156 19
5 161 183 22
6 204 226 22
7 236 258 22
8 265 287 22
9 302 321 19
10 407 429 22
11 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5760.t1
MGALLSIPLLAVPSVGSILTVTASCCGAATCSAVCSACGKFQNSMATRIAYAFILLINSILSWIMLTPWALKKLQ
HLTLDYMEIRCDGKECHGWVAVHRINFALGLFHLLLALLLLGVKSSKDTRAALQNGFWGPKVILWLAFIVMSFFI
PEPFFFVYGNYIAFFCAMLFLLLGLILLVDLAHSWAELCLQKIEDSDSRVWRGLLIGSTLGMYLASLVMTILMYI
FFAKSGCSMNQAAITVNLVVFLIISFVSVQPAVQESNSRAGLAQAAMVTVYCTYLTMSAVSMEPDDKNCNPLIRS
RGTRTATIVLGAIVTMLTIAYTTTRAATQGIALGSKGGHSYIQLGTDDNEHGLVTQQPNARREMRAEVLRAAVES
GSLPASALDESDDEDDYETTKDDERSSTQYNYSLFHIIFFLATTWVATLLVQGLTLETTTDFAPVGRTYWASWVK
IVSAWVCYAIYLWTLVAPVMLPDRFGVY*
Coding >Pro_DTO377G3_2|g5760.t1
ATGGGTGCCCTCCTTTCCATCCCGCTGTTGGCCGTGCCGAGCGTTGGTTCTATCCTGACAGTCACGGCATCATGC
TGTGGAGCAGCGACATGCTCTGCAGTCTGTAGCGCCTGCGGAAAGTTTCAAAACAGTATGGCGACGAGAATCGCT
TATGCCTTCATCCTTTTGATCAACTCTATACTCTCCTGGATTATGCTCACGCCATGGGCCCTGAAGAAATTGCAA
CATCTGACACTGGATTATATGGAGATTCGATGCGACGGGAAGGAATGTCACGGCTGGGTCGCGGTCCATCGTATT
AACTTTGCCCTCGGTCTCTTCCATTTACTCCTCGCCCTTTTGCTTCTTGGCGTCAAAAGCTCGAAAGATACTCGC
GCCGCTCTCCAAAATGGATTTTGGGGTCCGAAGGTCATCCTCTGGCTGGCCTTTATCGTCATGTCTTTCTTTATC
CCCGAACCCTTCTTCTTCGTCTATGGCAACTACATCGCCTTCTTCTGCGCCATGCTCTTCCTGCTTTTGGGTTTG
ATCCTTCTGGTGGACCTTGCGCACTCGTGGGCGGAGCTATGCCTGCAGAAGATCGAAGATAGCGACTCTCGCGTG
TGGCGCGGTCTGCTTATTGGTTCGACCCTCGGCATGTACTTGGCGTCTTTGGTCATGACCATCCTGATGTATATC
TTCTTCGCGAAGAGCGGTTGCTCTATGAACCAGGCTGCTATCACCGTTAACCTGGTTGTGTTTTTGATCATCTCT
TTCGTTTCTGTCCAACCAGCAGTGCAAGAATCGAACTCTCGCGCAGGACTGGCTCAGGCTGCAATGGTCACTGTC
TACTGCACCTACCTGACCATGTCTGCCGTTTCAATGGAACCGGATGACAAGAACTGCAACCCCCTCATCCGGTCC
CGCGGAACTAGGACTGCCACTATCGTCCTCGGTGCGATTGTCACTATGCTGACTATCGCATACACCACCACACGC
GCTGCTACCCAAGGAATTGCCTTGGGATCGAAGGGCGGCCACAGCTACATCCAGCTGGGCACGGATGACAACGAG
CACGGCTTGGTGACTCAACAACCAAATGCCCGTCGAGAGATGCGCGCTGAAGTTCTCCGGGCTGCTGTTGAGAGC
GGCAGTCTTCCTGCTAGTGCCCTGGATGAAAGTGACGACGAAGATGACTATGAAACCACGAAGGACGACGAGCGT
AGTTCAACACAATACAACTACTCGCTCTTCCACATCATCTTCTTCCTCGCCACAACGTGGGTAGCCACTTTGTTA
GTCCAGGGACTGACACTGGAGACCACGACAGATTTCGCACCGGTGGGCCGCACATACTGGGCCAGCTGGGTGAAG
ATCGTCAGCGCCTGGGTCTGCTATGCTATCTATCTTTGGACTCTGGTTGCGCCTGTTATGCTGCCAGATCGCTTC
GGTGTTTATTAG
Transcript >Pro_DTO377G3_2|g5760.t1
ATGGGTGCCCTCCTTTCCATCCCGCTGTTGGCCGTGCCGAGCGTTGGTTCTATCCTGACAGTCACGGCATCATGC
TGTGGAGCAGCGACATGCTCTGCAGTCTGTAGCGCCTGCGGAAAGTTTCAAAACAGTATGGCGACGAGAATCGCT
TATGCCTTCATCCTTTTGATCAACTCTATACTCTCCTGGATTATGCTCACGCCATGGGCCCTGAAGAAATTGCAA
CATCTGACACTGGATTATATGGAGATTCGATGCGACGGGAAGGAATGTCACGGCTGGGTCGCGGTCCATCGTATT
AACTTTGCCCTCGGTCTCTTCCATTTACTCCTCGCCCTTTTGCTTCTTGGCGTCAAAAGCTCGAAAGATACTCGC
GCCGCTCTCCAAAATGGATTTTGGGGTCCGAAGGTCATCCTCTGGCTGGCCTTTATCGTCATGTCTTTCTTTATC
CCCGAACCCTTCTTCTTCGTCTATGGCAACTACATCGCCTTCTTCTGCGCCATGCTCTTCCTGCTTTTGGGTTTG
ATCCTTCTGGTGGACCTTGCGCACTCGTGGGCGGAGCTATGCCTGCAGAAGATCGAAGATAGCGACTCTCGCGTG
TGGCGCGGTCTGCTTATTGGTTCGACCCTCGGCATGTACTTGGCGTCTTTGGTCATGACCATCCTGATGTATATC
TTCTTCGCGAAGAGCGGTTGCTCTATGAACCAGGCTGCTATCACCGTTAACCTGGTTGTGTTTTTGATCATCTCT
TTCGTTTCTGTCCAACCAGCAGTGCAAGAATCGAACTCTCGCGCAGGACTGGCTCAGGCTGCAATGGTCACTGTC
TACTGCACCTACCTGACCATGTCTGCCGTTTCAATGGAACCGGATGACAAGAACTGCAACCCCCTCATCCGGTCC
CGCGGAACTAGGACTGCCACTATCGTCCTCGGTGCGATTGTCACTATGCTGACTATCGCATACACCACCACACGC
GCTGCTACCCAAGGAATTGCCTTGGGATCGAAGGGCGGCCACAGCTACATCCAGCTGGGCACGGATGACAACGAG
CACGGCTTGGTGACTCAACAACCAAATGCCCGTCGAGAGATGCGCGCTGAAGTTCTCCGGGCTGCTGTTGAGAGC
GGCAGTCTTCCTGCTAGTGCCCTGGATGAAAGTGACGACGAAGATGACTATGAAACCACGAAGGACGACGAGCGT
AGTTCAACACAATACAACTACTCGCTCTTCCACATCATCTTCTTCCTCGCCACAACGTGGGTAGCCACTTTGTTA
GTCCAGGGACTGACACTGGAGACCACGACAGATTTCGCACCGGTGGGCCGCACATACTGGGCCAGCTGGGTGAAG
ATCGTCAGCGCCTGGGTCTGCTATGCTATCTATCTTTGGACTCTGGTTGCGCCTGTTATGCTGCCAGATCGCTTC
GGTGTTTATTAG
Gene >Pro_DTO377G3_2|g5760.t1
ATGGGTGCCCTCCTTTCCATCCCGCTGTTGGCCGTGCCGAGCGTTGGTTCTGTATGTTGTCGCCCAATCTCCAGT
TCACCATGTTACAGTTGCTAACTTGATTCTCTCTCTCAACAGATCCTGACAGTCACGGCATCATGCTGTGGAGCA
GCGACATGCTCTGCAGTCTGTAGCGCCTGCGGAAAGTTTCAAAACAGGTACCATCTCAACTGCCTAGTGCGGAGG
ATCTCGGACTAACAAAGACAGTATGGCGACGAGAATCGCTTATGCCTTCATCCTTTTGATCAACTCTATACTCTC
CTGGATTATGCTCACGCCATGGGCCCTGAAGAAATTGCAACATCTGACACTGGATTATATGGAGATTCGATGCGA
CGGGAAGGAATGTCACGGCTGGGTCGCGGTCCATCGTATTAACTTTGCCCTCGGTCTCTTCCATTTACTCCTCGC
CCTTTTGCTTCTTGGCGTCAAAAGCTCGAAAGATACTCGCGCCGCTCTCCAAAATGGATTTTGGGGTCCGAAGGT
CATCCTCTGGCTGGCCTTTATCGTCATGTCTTTCTTTATCCCCGAACCCTTCTTCTTCGTCTATGGCAACTACAT
CGCCTTCTTCTGCGCCATGCTCTTCCTGCTTTTGGGTTTGATCCTTCTGGTGGACCTTGCGCACTCGTGGGCGGA
GCTATGCCTGCAGAAGATCGAAGATAGCGACTCTCGCGTGTGGCGCGGTCTGCTTATTGGTTCGACCCTCGGCAT
GTACTTGGCGTCTTTGGTCATGACCATCCTGATGTATATCTTCTTCGCGAAGAGCGGTTGCTCTATGAACCAGGC
TGCTATCACCGTATGTATCCCACACCACCAATCTTAGCGCCTAACTGACTCGTCACAGGTTAACCTGGTTGTGTT
TTTGATCATCTCTTTCGTTTCTGTCCAACCAGCAGTGCAAGAATCGAACTCTCGCGCAGGACTGGCTCAGGCTGC
AATGGTCACTGTCTACTGCACCTACCTGACCATGTCTGCCGTTTCAATGGAACCGGATGACAAGAACTGCAACCC
CCTCATCCGGTCCCGCGGAACTAGGACTGCCACTATCGTCCTCGGTGCGATTGTCACTATGCTGACTATCGCATA
CACCACCACACGCGCTGCTACCCAAGGAATTGCCTTGGGATCGAAGGGCGGCCACAGCTACATCCAGCTGGGCAC
GGATGACAACGAGCACGGCTTGGTGACTCAACAACCAAATGCCCGTCGAGAGATGCGCGCTGAAGTTCTCCGGGC
TGCTGTTGAGAGCGGCAGTCTTCCTGCTAGTGCCCTGGATGAAAGTGACGACGAAGATGACTATGAAACCACGAA
GGACGACGAGCGTAGTTCAACACAATACAACTACTCGCTCTTCCACATCATCTTCTTCCTCGCCACAACGTGGGT
AGCCACTTTGTTAGTCCAGGGACTGACACTGGAGACCACGACAGATTTCGCACCGGTGGGCCGCACATACTGGGC
CAGCTGGGTGAAGATCGTCAGCGCCTGGGTCTGCTATGCTATCTATCTTTGGACTCTGGTTGCGCCTGTTATGCT
GCCAGATCGCTTCGGTGTTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail