Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5759.t1
Gene name
Locationscaffold_14:354585..356368
Strand-
Gene length (bp)1783
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06813 Nodulin-like Nodulin-like 2.9E-23 13 198
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-14 21 433

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 72 94 22
3 106 128 22
4 143 165 22
5 172 194 22
6 301 323 22
7 380 402 22
8 406 428 22
9 441 463 22
10 488 507 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 86.13 52.87 119.40
5d_25C Five days - 25 degrees Celsius 80.49 49.36 111.62
7d_25C Seven days - 25 degrees Celsius 69.86 42.45 97.26
10d_25C Ten days - 25 degrees Celsius 57.69 34.84 80.54
7d_15C Seven days - 15 degrees Celsius 135.00 81.29 188.72
7d_30C Seven days - 30 degrees Celsius 38.45 22.36 54.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.823951 no
3d_25C 7d_25C 0.395031 no
3d_25C 7d_15C 0.027737 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.055151 no
5d_25C 7d_25C 0.596201 no
5d_25C 7d_15C 0.009770 yes
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.124424 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.004840 yes
7d_25C 10d_25C 0.443940 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.067601 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5759.t1
MSGSLHRTARIISVIAGTLVALSCGTNYAYSAWAPQFAQRMKLSSTESNFIGVAGNLGMYAMGIPMGLLTDARGP
RLVALIGSVGLGLGYFPIYMAYDNGQGSMPVVFLCLFAFLTGMGGCSAFGGAIKTAASNFPDHRGTATAFPMAAF
GLSALFWSNLSTLIFKDDTGRFLLLLALGTSILSFASIPFLRILPSEPYSSIPHGGHESSDLDTVLEDSDLHGST
AFDHEQYPVHARSHSVASNSQGRAFSHADETANLVSKHDRPRPSFDTLDDDFLDEVAIEAHQTDIRGLAMLRKVE
FWQLFLTMALLSGIGLMTINNIGNSVKALWLYYDDSATDLFIQHRQVMHVSILSFGNFLGRLFSGIGSDLLVKKL
GMSRIWCLFLSAVVFTLTQLAGTTISNPNSLVVVSAFTGIAYGFLFGVFPSLTAHTFGIGGLSQNWGVMTLAPVF
SGNVFNLLYGNIYDAHSVVGHDGDRECPDGLGCYRSAYFMTFVSGLFGIAVCLWTIIRERNIDNIMNKKMDRLA*
Coding >Pro_DTO377G3_2|g5759.t1
ATGTCCGGCTCTCTACACCGAACTGCCCGGATTATTTCTGTCATTGCGGGGACGCTGGTCGCCCTCTCATGCGGA
ACCAATTATGCATACTCCGCGTGGGCGCCGCAATTCGCGCAGCGGATGAAGCTCTCATCCACCGAGAGCAACTTT
ATTGGTGTCGCGGGAAACCTGGGGATGTATGCTATGGGAATTCCAATGGGATTATTGACAGATGCCCGCGGTCCC
CGACTTGTCGCCCTGATCGGCTCTGTTGGCCTAGGCCTGGGTTACTTCCCAATTTATATGGCATATGATAATGGC
CAAGGATCGATGCCGGTTGTGTTCCTATGCCTTTTCGCTTTCCTTACTGGCATGGGCGGTTGCTCTGCCTTTGGC
GGTGCCATCAAAACAGCGGCATCGAACTTCCCCGACCACCGCGGCACGGCAACCGCTTTCCCGATGGCCGCCTTC
GGACTAAGCGCGCTATTCTGGTCCAACCTGTCGACTCTCATTTTCAAGGACGATACCGGCCGCTTCCTTCTGCTT
CTAGCCCTCGGAACCTCGATTCTGTCCTTTGCCTCAATCCCATTCCTTCGAATCCTCCCCAGCGAGCCGTACTCA
TCCATCCCACATGGCGGACACGAGTCTAGCGACCTTGATACCGTGCTAGAGGACTCCGATCTACATGGCTCTACC
GCTTTTGATCATGAACAATACCCCGTGCATGCGCGGTCGCACTCTGTTGCATCGAACTCCCAAGGCAGGGCATTC
AGCCATGCCGATGAGACTGCCAACTTGGTATCCAAGCACGACCGCCCGCGTCCCTCTTTCGATACACTTGACGAT
GACTTCTTGGATGAAGTGGCCATTGAGGCGCACCAAACTGATATCCGAGGTCTCGCCATGCTCCGCAAAGTCGAG
TTCTGGCAGCTCTTCTTGACCATGGCACTCTTGTCCGGTATCGGCTTGATGACCATCAACAACATCGGCAATAGC
GTGAAGGCCCTGTGGCTGTACTACGACGACAGCGCAACAGACCTGTTCATCCAACACCGCCAGGTCATGCACGTC
TCAATTCTCTCCTTCGGCAATTTCCTCGGCCGTCTGTTTAGCGGCATCGGCTCTGACCTACTAGTCAAGAAGCTC
GGCATGTCCCGCATCTGGTGTTTATTCTTGTCAGCGGTAGTCTTTACCCTGACCCAGCTCGCCGGCACCACCATT
TCCAACCCGAACAGCCTCGTCGTTGTCTCCGCCTTCACTGGAATCGCTTACGGGTTCTTGTTTGGCGTCTTCCCT
TCCCTAACCGCACACACTTTCGGCATTGGTGGCCTGTCCCAGAATTGGGGCGTCATGACACTAGCCCCAGTGTTC
AGTGGTAATGTCTTCAATTTGTTGTACGGTAATATCTACGACGCGCACTCTGTTGTCGGCCACGATGGCGACCGC
GAGTGTCCCGATGGATTGGGCTGCTACCGCTCAGCCTATTTCATGACTTTCGTTTCCGGCTTATTTGGTATCGCT
GTTTGTCTGTGGACCATCATCCGGGAGAGGAACATTGATAACATCATGAATAAGAAGATGGACCGACTCGCCTGA
Transcript >Pro_DTO377G3_2|g5759.t1
ATGTCCGGCTCTCTACACCGAACTGCCCGGATTATTTCTGTCATTGCGGGGACGCTGGTCGCCCTCTCATGCGGA
ACCAATTATGCATACTCCGCGTGGGCGCCGCAATTCGCGCAGCGGATGAAGCTCTCATCCACCGAGAGCAACTTT
ATTGGTGTCGCGGGAAACCTGGGGATGTATGCTATGGGAATTCCAATGGGATTATTGACAGATGCCCGCGGTCCC
CGACTTGTCGCCCTGATCGGCTCTGTTGGCCTAGGCCTGGGTTACTTCCCAATTTATATGGCATATGATAATGGC
CAAGGATCGATGCCGGTTGTGTTCCTATGCCTTTTCGCTTTCCTTACTGGCATGGGCGGTTGCTCTGCCTTTGGC
GGTGCCATCAAAACAGCGGCATCGAACTTCCCCGACCACCGCGGCACGGCAACCGCTTTCCCGATGGCCGCCTTC
GGACTAAGCGCGCTATTCTGGTCCAACCTGTCGACTCTCATTTTCAAGGACGATACCGGCCGCTTCCTTCTGCTT
CTAGCCCTCGGAACCTCGATTCTGTCCTTTGCCTCAATCCCATTCCTTCGAATCCTCCCCAGCGAGCCGTACTCA
TCCATCCCACATGGCGGACACGAGTCTAGCGACCTTGATACCGTGCTAGAGGACTCCGATCTACATGGCTCTACC
GCTTTTGATCATGAACAATACCCCGTGCATGCGCGGTCGCACTCTGTTGCATCGAACTCCCAAGGCAGGGCATTC
AGCCATGCCGATGAGACTGCCAACTTGGTATCCAAGCACGACCGCCCGCGTCCCTCTTTCGATACACTTGACGAT
GACTTCTTGGATGAAGTGGCCATTGAGGCGCACCAAACTGATATCCGAGGTCTCGCCATGCTCCGCAAAGTCGAG
TTCTGGCAGCTCTTCTTGACCATGGCACTCTTGTCCGGTATCGGCTTGATGACCATCAACAACATCGGCAATAGC
GTGAAGGCCCTGTGGCTGTACTACGACGACAGCGCAACAGACCTGTTCATCCAACACCGCCAGGTCATGCACGTC
TCAATTCTCTCCTTCGGCAATTTCCTCGGCCGTCTGTTTAGCGGCATCGGCTCTGACCTACTAGTCAAGAAGCTC
GGCATGTCCCGCATCTGGTGTTTATTCTTGTCAGCGGTAGTCTTTACCCTGACCCAGCTCGCCGGCACCACCATT
TCCAACCCGAACAGCCTCGTCGTTGTCTCCGCCTTCACTGGAATCGCTTACGGGTTCTTGTTTGGCGTCTTCCCT
TCCCTAACCGCACACACTTTCGGCATTGGTGGCCTGTCCCAGAATTGGGGCGTCATGACACTAGCCCCAGTGTTC
AGTGGTAATGTCTTCAATTTGTTGTACGGTAATATCTACGACGCGCACTCTGTTGTCGGCCACGATGGCGACCGC
GAGTGTCCCGATGGATTGGGCTGCTACCGCTCAGCCTATTTCATGACTTTCGTTTCCGGCTTATTTGGTATCGCT
GTTTGTCTGTGGACCATCATCCGGGAGAGGAACATTGATAACATCATGAATAAGAAGATGGACCGACTCGCCTGA
Gene >Pro_DTO377G3_2|g5759.t1
ATGTCCGGCTCTCTACACCGAACTGCCCGGATTATTTCTGTCATTGCGGGGACGCTGGTCGCCCTCTCATGCGGA
ACCAATGTGCGTGATATCTCCGGTCTCATCCCCATTCAGGACCATTAAGGTTAACCCATCTTAGTATGCATACTC
CGCGTGGGCGCCGCAATTCGCGCAGCGGATGAAGCTCTCATCCACCGAGAGCAACTTTATTGTGAGTAATGCCAT
GTCCGGTGTCGGGAAACGGGTTTTAACAGTGTCTAGGGTGTCGCGGGAAACCTGGGGATGTATGCTATGGGAATT
CCAATGGGATTATTGACAGATGCCCGCGGTCCCCGACTTGTCGCCCTGATCGGCTCTGTTGGCCTAGGCCTGGGT
TACTTCCCAATTTATATGGGTATGTGTTGAGGTTACCTTGTCGGAATTGAGCAGCTCTAATGTCTGTAGCATATG
ATAATGGCCAAGGATCGATGCCGGTTGTGTTCCTATGCCTTTTCGCTTTCCTTACTGGCATGGGCGGTTGCTCTG
CCTTTGGCGGTGCCATCAAAACAGGTATGTTACACTAAGTAATTTGCTTAATAGAGTTAACCTAATGATTCCAGC
GGCATCGAACTTCCCCGACCACCGCGGCACGGCAACCGCTTTCCCGATGGCCGCCTTCGGACTAAGCGCGCTATT
CTGGTCCAACCTGTCGACTCTCATTTTCAAGGACGATACCGGCCGCTTCCTTCTGCTTCTAGCCCTCGGAACCTC
GATTCTGTCCTTTGCCTCAATCCCATTCCTTCGAATCCTCCCCAGCGAGCCGTACTCATCCATCCCACATGGCGG
ACACGAGTCTAGCGACCTTGATACCGTGCTAGAGGACTCCGATCTACATGGCTCTACCGCTTTTGATCATGAACA
ATACCCCGTGCATGCGCGGTCGCACTCTGTTGCATCGAACTCCCAAGGCAGGGCATTCAGCCATGCCGATGAGAC
TGCCAACTTGGTATCCAAGCACGACCGCCCGCGTCCCTCTTTCGATACACTTGACGATGACTTCTTGGATGAAGT
GGCCATTGAGGCGCACCAAACTGATATCCGAGGTCTCGCCATGCTCCGCAAAGTCGAGTTCTGGCAGCTCTTCTT
GACCATGGCACTCTTGTCCGGTATCGGCTTGATGACCATCAACAACATCGGCAATAGCGTGAAGGCCCTGTGGCT
GTACTACGACGACAGCGCAACAGACCTGTTCATCCAACACCGCCAGGTCATGCACGTCTCAATTCTCTCCTTCGG
CAATTTCCTCGGCCGTCTGTTTAGCGGCATCGGCTCTGACCTACTAGTCAAGAAGCTCGGCATGTCCCGCATCTG
GTGTTTATTCTTGTCAGCGGTAGTCTTTACCCTGACCCAGCTCGCCGGCACCACCATTTCCAACCCGAACAGCCT
CGTCGTTGTCTCCGCCTTCACTGGAATCGCTTACGGGTTCTTGTTTGGCGTCTTCCCTTCCCTAACCGCACACAC
TTTCGGCATTGGTGGCCTGTCCCAGAATTGGGGCGTCATGACACTAGCCCCAGTGTTCAGTGGTAATGTCTTCAA
TTTGTTGTACGGTAATATCTACGACGCGCACTCTGTTGTCGGCCACGATGGCGACCGCGAGTGTCCCGATGGATT
GGGCTGCTACCGCTCAGCCTATTTCATGACTTTCGTTTCCGGCTTATTTGGTATCGCTGTTTGTCTGTGGACCAT
CATCCGGGAGAGGAACATTGATAACATCATGAATAAGAAGATGGACCGACTCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail