Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5758.t1
Gene name
Locationscaffold_14:351610..353619
Strand+
Gene length (bp)2009
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 4.4E-15 152 185

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003676 nucleic acid binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0050789 regulation of biological process No
GO:0005488 binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009889 regulation of biosynthetic process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 106.73 64.81 148.66
5d_25C Five days - 25 degrees Celsius 94.62 56.40 132.84
7d_25C Seven days - 25 degrees Celsius 83.83 50.42 117.24
10d_25C Ten days - 25 degrees Celsius 63.07 37.53 88.60
7d_15C Seven days - 15 degrees Celsius 64.54 37.35 91.73
7d_30C Seven days - 30 degrees Celsius 76.61 45.19 108.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.669579 no
3d_25C 7d_25C 0.321984 no
3d_25C 7d_15C 0.018560 yes
3d_25C 7d_30C 0.146998 no
3d_25C 10d_25C 0.012609 yes
5d_25C 7d_25C 0.670787 no
5d_25C 7d_15C 0.088918 no
5d_25C 7d_30C 0.407456 no
5d_25C 10d_25C 0.057058 no
7d_25C 7d_15C 0.286152 no
7d_25C 7d_30C 0.767276 no
7d_25C 10d_25C 0.219134 no
7d_15C 7d_30C 0.537227 no
7d_15C 10d_25C 0.949724 no
7d_30C 10d_25C 0.453506 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5758.t1
MSIVGPKPLAPFRPIDLESCSESVVPNRIRIPSRDSFDTYPFSFNSEREFPYDLSADNSSTRHASNGSTQFSTTL
PDIKSVTKFGSGESDGYPGSSVSTSLPGLAALASVASAPTSNLRSSSDTSMGMANMTYATSSPAATTGGQGSGPP
VCQNCGTSTTPLWRRDELGSVLCNACGLFLKLHGRPRPISLKTDVIKSRNRVKTGQGPKRKSGGPVDTNGIPPRS
EAGTPPPLGSHGYRRASRKMSSGHSDRSNSPVSRTETPGFGSMHAHNSNIAPQHMFDSVTLGDSMNSSSGLPSRQ
MRQPSPSAVDRQLDSPHTYESLLALNTSLKTRVSELEFVNELFRGRVTELEQSDASARRSEMIVRDSEVRLRRSL
EDAQRREEDLKRRISDLERQLGSSGAGDAESGEPLAKKIRLSDVVESGEDVLVKSPKSV*
Coding >Pro_DTO377G3_2|g5758.t1
ATGTCAATTGTCGGGCCTAAGCCTCTCGCTCCTTTCCGACCCATTGACCTAGAGTCCTGTTCCGAGTCCGTTGTT
CCCAATCGCATTCGCATCCCGTCGCGCGATTCGTTCGACACCTACCCTTTCTCTTTCAATTCGGAGCGTGAGTTC
CCTTACGACTTGTCCGCCGACAATTCTTCGACCCGTCACGCGTCCAACGGATCGACACAGTTTTCCACGACACTG
CCGGATATCAAGAGCGTGACCAAATTCGGCTCAGGCGAGAGCGACGGATACCCAGGCTCTTCTGTTAGCACCTCG
CTTCCTGGACTTGCAGCACTGGCTTCGGTCGCTTCGGCACCAACCTCTAATCTTCGCTCATCCAGTGATACGAGT
ATGGGTATGGCAAATATGACCTACGCTACGTCGTCACCAGCGGCTACGACAGGAGGACAAGGGAGTGGACCTCCT
GTTTGCCAAAATTGCGGCACCTCTACCACGCCCCTGTGGCGTAGGGACGAACTCGGTTCAGTCCTCTGCAACGCA
TGTGGACTGTTCCTGAAACTGCATGGTCGACCTCGTCCGATAAGCTTGAAAACGGATGTGATTAAAAGTCGCAAT
CGCGTGAAGACTGGTCAGGGCCCTAAGCGCAAGTCAGGCGGCCCTGTCGATACCAATGGCATTCCGCCGCGATCT
GAGGCGGGAACTCCTCCTCCCCTCGGCTCGCATGGATACCGTCGCGCGTCGCGCAAGATGTCCTCGGGTCATTCG
GATCGTTCCAACTCCCCCGTTTCCCGGACCGAGACACCTGGCTTTGGCTCGATGCACGCGCACAACTCGAATATC
GCACCGCAGCACATGTTCGACAGCGTCACCCTAGGCGATAGCATGAACTCCTCCAGCGGCCTCCCCTCCCGCCAG
ATGCGCCAGCCCTCTCCCTCGGCAGTCGACCGCCAACTCGATTCCCCCCACACCTATGAAAGTCTTCTGGCTCTA
AACACATCCCTGAAGACACGCGTCAGTGAACTTGAGTTCGTCAATGAGCTCTTCCGCGGTCGCGTGACGGAACTC
GAGCAGAGTGACGCCAGCGCGCGTCGGTCGGAGATGATTGTACGAGACTCCGAGGTTCGTCTGAGACGGTCTCTG
GAGGATGCTCAGCGCCGCGAGGAGGATCTCAAGCGTCGTATTAGCGATCTCGAGCGCCAGCTCGGTTCTAGCGGC
GCTGGTGACGCCGAGTCCGGCGAGCCGCTCGCAAAAAAGATCCGCCTGTCGGATGTTGTGGAATCTGGCGAGGAT
GTACTTGTCAAGTCTCCCAAGAGCGTTTAG
Transcript >Pro_DTO377G3_2|g5758.t1
ATGTCAATTGTCGGGCCTAAGCCTCTCGCTCCTTTCCGACCCATTGACCTAGAGTCCTGTTCCGAGTCCGTTGTT
CCCAATCGCATTCGCATCCCGTCGCGCGATTCGTTCGACACCTACCCTTTCTCTTTCAATTCGGAGCGTGAGTTC
CCTTACGACTTGTCCGCCGACAATTCTTCGACCCGTCACGCGTCCAACGGATCGACACAGTTTTCCACGACACTG
CCGGATATCAAGAGCGTGACCAAATTCGGCTCAGGCGAGAGCGACGGATACCCAGGCTCTTCTGTTAGCACCTCG
CTTCCTGGACTTGCAGCACTGGCTTCGGTCGCTTCGGCACCAACCTCTAATCTTCGCTCATCCAGTGATACGAGT
ATGGGTATGGCAAATATGACCTACGCTACGTCGTCACCAGCGGCTACGACAGGAGGACAAGGGAGTGGACCTCCT
GTTTGCCAAAATTGCGGCACCTCTACCACGCCCCTGTGGCGTAGGGACGAACTCGGTTCAGTCCTCTGCAACGCA
TGTGGACTGTTCCTGAAACTGCATGGTCGACCTCGTCCGATAAGCTTGAAAACGGATGTGATTAAAAGTCGCAAT
CGCGTGAAGACTGGTCAGGGCCCTAAGCGCAAGTCAGGCGGCCCTGTCGATACCAATGGCATTCCGCCGCGATCT
GAGGCGGGAACTCCTCCTCCCCTCGGCTCGCATGGATACCGTCGCGCGTCGCGCAAGATGTCCTCGGGTCATTCG
GATCGTTCCAACTCCCCCGTTTCCCGGACCGAGACACCTGGCTTTGGCTCGATGCACGCGCACAACTCGAATATC
GCACCGCAGCACATGTTCGACAGCGTCACCCTAGGCGATAGCATGAACTCCTCCAGCGGCCTCCCCTCCCGCCAG
ATGCGCCAGCCCTCTCCCTCGGCAGTCGACCGCCAACTCGATTCCCCCCACACCTATGAAAGTCTTCTGGCTCTA
AACACATCCCTGAAGACACGCGTCAGTGAACTTGAGTTCGTCAATGAGCTCTTCCGCGGTCGCGTGACGGAACTC
GAGCAGAGTGACGCCAGCGCGCGTCGGTCGGAGATGATTGTACGAGACTCCGAGGTTCGTCTGAGACGGTCTCTG
GAGGATGCTCAGCGCCGCGAGGAGGATCTCAAGCGTCGTATTAGCGATCTCGAGCGCCAGCTCGGTTCTAGCGGC
GCTGGTGACGCCGAGTCCGGCGAGCCGCTCGCAAAAAAGATCCGCCTGTCGGATGTTGTGGAATCTGGCGAGGAT
GTACTTGTCAAGTCTCCCAAGAGCGTTTAG
Gene >Pro_DTO377G3_2|g5758.t1
ATGTCGTTAATTTAAGTCTTCGTTCTGTTCTTTGGTCTTATTTACTTCTTCAGGCACAAGAATTGTCGGGCCTAA
GCCTCTCGCTCCTTTCCGGTATCGATCATTACTGCTCGGAACTTCATATCGAATTGATCACTGAAGGAATTGTCT
TGATATAGACCCATTGACCTAGAGTCCTGTTCCGAGTCCGTTGTTCCCAATCGCATTCGCATCCCGTCGCGCGAT
TCGTTCGACACCTACCCTTTCTCTTTCAATTCGGTTTGAGGCCGGATTTCAATCAACACCCACTTTCCCCCTCCA
CGGTGGCTTCCACCCTCTATCGGGCGTCGCCCATCGACCCGGCTATCAAATCCCGTTCTTCGCAGGAGCGTGAGT
TCCCTTACGACTTGTCCGCCGACAATTCTTCGACCCGTCACGCGTCCAACGGATCGACACAGTTTTCCACGACAC
TGCCGGATATCAAGAGCGTGACCAAATTCGGCTCAGGCGAGAGCGACGGATACCCAGGCTCTTCTGTTAGCACCT
CGCTTCCTGGACTTGCAGCACTGGCTTCGGTCGCTTCGGCACCAACCTCTAATCTTCGGTGCGTTGATACCCCAT
ACCAGTCCTCAATGGAAGCCACCCGTGGACCTTTGGGCGACCTATCTTATTGCGTAATCTTCACTCGGGCACCTG
GAGAGCAGTAATCTGGCCCCTCATAAGAATTCGAATCAATTGGCTAATCCATATATTTCCCCTCCCATTTTTAGC
TCATCCAGTGATACGAGTATGGGTATGGCAAATATGACCTACGCTACGTCGTCACCAGCGGCTACGACAGGAGGA
CAAGGGAGTGGACCTGTAAGTGTGAAATATGTGTTATCGGCGCGCTGGGTCTTATCTCTGAGGAGTTATCGAAAG
TCTTGGCGCCACTCGATCCGTGCACCCGCTTTTTCCCTTTCCTTATCGACTCAAATCTCTACAATCTTATCATCC
TCTTCCTCTTCCTCACTTCTATACCCTCATAATGGCGACCACATTGACTGACGACAAGCGACCTCAATTACAGCC
TGTTTGCCAAAATTGCGGCACCTCTACCACGCCCCTGTGGCGTAGGGACGAACTCGGTTCAGTCCTCTGCAACGC
ATGTGGACTGTTCCTGAAACTGCATGGTCGACCTCGTCCGATAAGCTTGAAAACGGATGTGATTAAAAGTCGCAA
TCGCGTGAAGACTGGTCAGGGCCCTAAGCGCAAGGTGAGTTCGCGATCAAAAAAATTTTCTCCCCGTCCCCTACG
CCCAATCCAATCCCACCTATCTTAGATAAGAACATGCGCTAATCAGGACTGTGATTCTATAGTCAGGCGGCCCTG
TCGATACCAATGGCATTCCGCCGCGATCTGAGGCGGGAACTCCTCCTCCCCTCGGCTCGCATGGATACCGTCGCG
CGTCGCGCAAGATGTCCTCGGGTCATTCGGATCGTTCCAACTCCCCCGTTTCCCGGACCGAGACACCTGGCTTTG
GCTCGATGCACGCGCACAACTCGAATATCGCACCGCAGCACATGTTCGACAGCGTCACCCTAGGCGATAGCATGA
ACTCCTCCAGCGGCCTCCCCTCCCGCCAGATGCGCCAGCCCTCTCCCTCGGCAGTCGACCGCCAACTCGATTCCC
CCCACACCTATGAAAGTCTTCTGGCTCTAAACACATCCCTGAAGACACGCGTCAGTGAACTTGAGTTCGTCAATG
AGCTCTTCCGCGGTCGCGTGACGGAACTCGAGCAGAGTGACGCCAGCGCGCGTCGGTCGGAGATGATTGTACGAG
ACTCCGAGGTTCGTCTGAGACGGTCTCTGGAGGATGCTCAGCGCCGCGAGGAGGATCTCAAGCGTCGTATTAGCG
ATCTCGAGCGCCAGCTCGGTTCTAGCGGCGCTGGTGACGCCGAGTCCGGCGAGCCGCTCGCAAAAAAGATCCGCC
TGTCGGATGTTGTGGAATCTGGCGAGGATGTACTTGTCAAGTCTCCCAAGAGCGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail