Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5752.t1
Gene name
Locationscaffold_14:335533..336217
Strand-
Gene length (bp)684
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat 4.6E-25 73 125
PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat 4.2E-16 36 66

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5752.t1
MSNLPYAADAESPLKPAELQVLRAQYEKEGDYVGIQTKFNYAWGLIKSNIRSEQQEGVRLLSEIFRGAPERRREC
LYYLALGNFKLGNYGEARRYNDLLLEKEPANLQAASLGSLIDDKVAKEGLVGVAIVSGLALVAGIVGSLVIKGAR
RR*
Coding >Pro_DTO377G3_2|g5752.t1
ATGTCCAATCTTCCATACGCTGCTGATGCGGAAAGTCCCTTGAAACCCGCGGAGCTACAGGTCCTGAGAGCCCAA
TACGAGAAAGAAGGCGACTATGTCGGGATCCAGACAAAGTTCAACTACGCATGGGGTCTGATCAAATCCAACATC
CGTTCCGAACAGCAAGAAGGCGTTCGCTTGCTTTCAGAGATCTTCCGTGGAGCTCCGGAGCGACGACGCGAATGC
CTCTATTATCTAGCCCTCGGCAACTTCAAGCTAGGGAACTACGGCGAAGCCCGCCGATACAACGATTTGCTCCTG
GAGAAGGAGCCCGCAAACCTCCAGGCTGCCAGCCTTGGGTCGCTCATCGATGATAAAGTCGCCAAGGAGGGTCTG
GTAGGCGTCGCGATTGTTAGTGGCTTGGCTCTCGTCGCGGGTATCGTTGGTAGTCTGGTGATCAAGGGAGCCAGA
AGACGATAA
Transcript >Pro_DTO377G3_2|g5752.t1
ATGTCCAATCTTCCATACGCTGCTGATGCGGAAAGTCCCTTGAAACCCGCGGAGCTACAGGTCCTGAGAGCCCAA
TACGAGAAAGAAGGCGACTATGTCGGGATCCAGACAAAGTTCAACTACGCATGGGGTCTGATCAAATCCAACATC
CGTTCCGAACAGCAAGAAGGCGTTCGCTTGCTTTCAGAGATCTTCCGTGGAGCTCCGGAGCGACGACGCGAATGC
CTCTATTATCTAGCCCTCGGCAACTTCAAGCTAGGGAACTACGGCGAAGCCCGCCGATACAACGATTTGCTCCTG
GAGAAGGAGCCCGCAAACCTCCAGGCTGCCAGCCTTGGGTCGCTCATCGATGATAAAGTCGCCAAGGAGGGTCTG
GTAGGCGTCGCGATTGTTAGTGGCTTGGCTCTCGTCGCGGGTATCGTTGGTAGTCTGGTGATCAAGGGAGCCAGA
AGACGATAA
Gene >Pro_DTO377G3_2|g5752.t1
ATGTCCAATCTTCCATGTAGGTGGTTCCGACCGATTGCCTGATGCCTGATGTTTGAAGACTGACTTGCTGACTTG
TTATGTCACTCCAGACGCTGCTGATGCGGAAAGGTTTGTTTTCTGCGGAAACTCCGAAAGAAAATATCGGAATCG
TCCGAACTGACTTGACTATCACCGACACAGTCCCTTGAAACCCGCGGAGCTACAGGTCCTGAGAGCCCAATACGA
GAAAGAAGGCGACTATGTCGGGATCCAGACAAAGTTCAACTACGCATGGGTATCGTTTATCCAGTCCTGATCAGG
TGTGCCCGCGCTGACCGGTGTTCCCCGCCTATGCGGGGTTGGCATTGACTATAGGGTCTGATCAAATCCAACATC
CGTTCCGAACAGCAAGAAGGCGTTCGCTTGCTTTCAGAGATCTTCCGTGGAGCTCCGGAGCGACGACGCGAATGC
CTCTATTATCTAGCCCTCGGCAACTTCAAGCTAGGGAACTACGGCGAAGCCCGCCGATACAACGATTTGCTCCTG
GAGAAGGAGCCCGCAAACCTCCAGGCTGCCAGCCTTGGGTCGCTCATCGATGATAAAGTCGCCAAGGAGGGTCTG
GTAGGCGTCGCGATTGTTAGTGGCTTGGCTCTCGTCGCGGGTATCGTTGGTAGTCTGGTGATCAAGGGAGCCAGA
AGACGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail