Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5746.t1
Gene name
Locationscaffold_14:312806..315144
Strand-
Gene length (bp)2338
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09402 MSC Man1-Src1p-C-terminal domain 3.8E-107 347 670
PF12949 HeH HeH/LEM domain 4.3E-16 14 48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 550 572 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5746.t1
MADELEYLHPDFDLNSLTVPRLRSILVNHDVPYPASAKKAQLIGILEDEVLPQARKLLRDRDRVRRTSAGITDMG
SRSTSVASDVNDRESMPPPPTPSTVGSTSRSMRGTSRRSTRHSTVDTDDGLEPATPIRNTKRTSVARSVGKHART
SDTETGDDTLATPIAATRPTPRKSTARKIGRSEILPSTELDEHTRIKSEPRNESMFTDDNPFQSGSPEAPKSARM
SYDGKRKSVSRLSTDSPARGRGLRSRKSATPSNVQQDDGFQPPKRDSFDFASRLMPPQEEPEEESDESEDDEGSE
IGAGEEFTPEEQLAMSMEDDQYSPQIQARRRPQKQSTLSRLAPWVVILSLVGSFGTWWRKEKLEIGYCGLGKPTW
SLADTKVPEWANVLEPRCEPCPSHAFCYPDFVVRCENDFLLKPHPLALGGLVPLPPTCEPDSEKERRVKAVADKA
VEELRERRAKWECGQLKEDGKGARSPDISEPELREEVAKKRRKGMSDTEFDELWKGAIGEILEKDEVISKTKQNS
AILILSSTSIARLPLACAVRRYFRLTLLAYRLPISLLIMTIGLLVYARARVLARRSDIARVPELVATTLDRLSTQ
AALYARGDAKEPHIAIGQLRDDVLRFELQGKRREELWRRVRSFVEGNANVRASVREGRSGDVSRVWEWIGGINAV
GEPEHIGRRESARFSVPSPSGNIVTSPQTPASESQPEPISSPRESRRWDESRPIY*
Coding >Pro_DTO377G3_2|g5746.t1
ATGGCGGATGAACTGGAATATCTCCATCCAGATTTCGATCTGAACTCTCTCACCGTGCCTCGTCTCCGCTCGATC
CTTGTCAACCACGATGTTCCCTACCCTGCCTCTGCAAAGAAGGCTCAACTGATCGGCATCCTCGAAGATGAAGTT
CTTCCGCAAGCCAGAAAACTCTTGCGTGACCGCGACAGGGTTCGACGGACCAGTGCAGGTATTACAGATATGGGC
AGTCGGTCTACATCGGTGGCAAGCGACGTGAACGACAGAGAGTCGATGCCTCCTCCACCCACACCCTCAACAGTC
GGATCCACAAGCAGAAGCATGCGAGGCACATCGCGTCGCAGCACCCGTCACTCAACGGTAGATACAGATGATGGT
CTGGAACCTGCCACACCTATAAGGAACACAAAACGCACGAGCGTCGCTCGCTCGGTGGGTAAACACGCTCGCACA
TCTGACACGGAAACCGGCGACGACACACTCGCGACTCCAATCGCTGCTACCCGTCCTACGCCTCGCAAGTCTACA
GCTAGAAAAATCGGACGGAGCGAGATCCTCCCTTCGACAGAACTGGATGAACACACTCGTATTAAGTCAGAACCA
CGCAACGAGAGCATGTTTACGGATGATAATCCCTTTCAAAGTGGAAGCCCTGAGGCCCCTAAAAGCGCAAGGATG
AGTTATGATGGCAAGCGGAAGAGCGTTTCGCGCTTATCTACAGACAGTCCAGCTCGGGGTCGCGGACTCAGGTCG
CGGAAATCAGCAACCCCGTCCAACGTTCAGCAAGACGATGGCTTCCAGCCACCGAAGCGGGATTCGTTTGATTTC
GCCTCCCGGCTGATGCCTCCACAGGAGGAACCTGAGGAGGAATCGGATGAATCCGAGGATGATGAAGGGAGCGAA
ATTGGCGCAGGTGAAGAATTCACACCTGAGGAACAGCTCGCTATGTCTATGGAGGATGACCAGTACTCGCCACAA
ATTCAGGCTAGACGACGGCCCCAAAAGCAAAGCACTCTCAGCCGCTTGGCACCTTGGGTAGTCATCCTGTCACTG
GTCGGTAGTTTTGGTACCTGGTGGCGCAAAGAAAAACTCGAGATTGGATATTGCGGCCTAGGAAAGCCCACCTGG
TCTTTGGCAGACACTAAAGTTCCTGAATGGGCGAATGTGCTGGAGCCCCGGTGCGAGCCGTGCCCAAGCCACGCC
TTCTGCTACCCAGACTTTGTAGTCCGCTGCGAAAATGATTTCCTGTTGAAGCCGCATCCTCTCGCCCTCGGAGGC
CTAGTGCCGTTGCCGCCAACATGTGAACCTGATAGTGAAAAGGAACGCCGCGTGAAGGCCGTTGCTGATAAAGCT
GTTGAGGAGCTTCGTGAGCGCCGGGCAAAGTGGGAATGCGGTCAGCTAAAGGAAGACGGGAAGGGCGCCAGATCT
CCAGACATCAGCGAGCCAGAGTTGAGGGAAGAGGTGGCTAAGAAACGCCGCAAGGGCATGAGTGACACGGAATTT
GATGAGCTGTGGAAGGGCGCCATTGGGGAGATCCTTGAAAAAGATGAAGTTATTAGCAAGACCAAGCAAAATTCC
GCCATCCTCATCCTCTCCTCCACCTCCATTGCACGGCTCCCACTCGCATGCGCCGTCCGCCGCTACTTCCGACTC
ACTCTCCTCGCGTATCGACTCCCTATTTCACTTTTAATCATGACCATCGGTCTTCTTGTGTACGCTCGTGCGCGT
GTCCTCGCACGTCGGTCTGACATTGCTCGCGTGCCCGAATTGGTAGCTACAACCCTCGACCGACTATCCACGCAG
GCTGCACTATACGCCCGCGGTGATGCCAAAGAACCTCATATTGCCATCGGGCAGCTCCGCGATGACGTTCTCCGC
TTTGAACTCCAGGGCAAGCGTCGCGAGGAGCTCTGGCGACGGGTCCGCAGCTTTGTCGAAGGCAACGCCAACGTC
CGCGCTTCTGTGCGTGAAGGACGTAGCGGTGATGTTTCTCGGGTCTGGGAGTGGATCGGTGGGATTAACGCTGTC
GGCGAGCCGGAACATATTGGCCGCCGTGAGAGTGCACGATTCTCCGTCCCTTCTCCATCCGGTAATATTGTGACA
AGCCCTCAGACGCCTGCGAGTGAAAGCCAGCCCGAGCCTATTTCTAGCCCAAGAGAGTCTCGCCGCTGGGACGAG
AGCCGTCCGATCTATTGA
Transcript >Pro_DTO377G3_2|g5746.t1
ATGGCGGATGAACTGGAATATCTCCATCCAGATTTCGATCTGAACTCTCTCACCGTGCCTCGTCTCCGCTCGATC
CTTGTCAACCACGATGTTCCCTACCCTGCCTCTGCAAAGAAGGCTCAACTGATCGGCATCCTCGAAGATGAAGTT
CTTCCGCAAGCCAGAAAACTCTTGCGTGACCGCGACAGGGTTCGACGGACCAGTGCAGGTATTACAGATATGGGC
AGTCGGTCTACATCGGTGGCAAGCGACGTGAACGACAGAGAGTCGATGCCTCCTCCACCCACACCCTCAACAGTC
GGATCCACAAGCAGAAGCATGCGAGGCACATCGCGTCGCAGCACCCGTCACTCAACGGTAGATACAGATGATGGT
CTGGAACCTGCCACACCTATAAGGAACACAAAACGCACGAGCGTCGCTCGCTCGGTGGGTAAACACGCTCGCACA
TCTGACACGGAAACCGGCGACGACACACTCGCGACTCCAATCGCTGCTACCCGTCCTACGCCTCGCAAGTCTACA
GCTAGAAAAATCGGACGGAGCGAGATCCTCCCTTCGACAGAACTGGATGAACACACTCGTATTAAGTCAGAACCA
CGCAACGAGAGCATGTTTACGGATGATAATCCCTTTCAAAGTGGAAGCCCTGAGGCCCCTAAAAGCGCAAGGATG
AGTTATGATGGCAAGCGGAAGAGCGTTTCGCGCTTATCTACAGACAGTCCAGCTCGGGGTCGCGGACTCAGGTCG
CGGAAATCAGCAACCCCGTCCAACGTTCAGCAAGACGATGGCTTCCAGCCACCGAAGCGGGATTCGTTTGATTTC
GCCTCCCGGCTGATGCCTCCACAGGAGGAACCTGAGGAGGAATCGGATGAATCCGAGGATGATGAAGGGAGCGAA
ATTGGCGCAGGTGAAGAATTCACACCTGAGGAACAGCTCGCTATGTCTATGGAGGATGACCAGTACTCGCCACAA
ATTCAGGCTAGACGACGGCCCCAAAAGCAAAGCACTCTCAGCCGCTTGGCACCTTGGGTAGTCATCCTGTCACTG
GTCGGTAGTTTTGGTACCTGGTGGCGCAAAGAAAAACTCGAGATTGGATATTGCGGCCTAGGAAAGCCCACCTGG
TCTTTGGCAGACACTAAAGTTCCTGAATGGGCGAATGTGCTGGAGCCCCGGTGCGAGCCGTGCCCAAGCCACGCC
TTCTGCTACCCAGACTTTGTAGTCCGCTGCGAAAATGATTTCCTGTTGAAGCCGCATCCTCTCGCCCTCGGAGGC
CTAGTGCCGTTGCCGCCAACATGTGAACCTGATAGTGAAAAGGAACGCCGCGTGAAGGCCGTTGCTGATAAAGCT
GTTGAGGAGCTTCGTGAGCGCCGGGCAAAGTGGGAATGCGGTCAGCTAAAGGAAGACGGGAAGGGCGCCAGATCT
CCAGACATCAGCGAGCCAGAGTTGAGGGAAGAGGTGGCTAAGAAACGCCGCAAGGGCATGAGTGACACGGAATTT
GATGAGCTGTGGAAGGGCGCCATTGGGGAGATCCTTGAAAAAGATGAAGTTATTAGCAAGACCAAGCAAAATTCC
GCCATCCTCATCCTCTCCTCCACCTCCATTGCACGGCTCCCACTCGCATGCGCCGTCCGCCGCTACTTCCGACTC
ACTCTCCTCGCGTATCGACTCCCTATTTCACTTTTAATCATGACCATCGGTCTTCTTGTGTACGCTCGTGCGCGT
GTCCTCGCACGTCGGTCTGACATTGCTCGCGTGCCCGAATTGGTAGCTACAACCCTCGACCGACTATCCACGCAG
GCTGCACTATACGCCCGCGGTGATGCCAAAGAACCTCATATTGCCATCGGGCAGCTCCGCGATGACGTTCTCCGC
TTTGAACTCCAGGGCAAGCGTCGCGAGGAGCTCTGGCGACGGGTCCGCAGCTTTGTCGAAGGCAACGCCAACGTC
CGCGCTTCTGTGCGTGAAGGACGTAGCGGTGATGTTTCTCGGGTCTGGGAGTGGATCGGTGGGATTAACGCTGTC
GGCGAGCCGGAACATATTGGCCGCCGTGAGAGTGCACGATTCTCCGTCCCTTCTCCATCCGGTAATATTGTGACA
AGCCCTCAGACGCCTGCGAGTGAAAGCCAGCCCGAGCCTATTTCTAGCCCAAGAGAGTCTCGCCGCTGGGACGAG
AGCCGTCCGATCTATTGA
Gene >Pro_DTO377G3_2|g5746.t1
ATGGCGGATGAACTGGAATATCTCCATCCAGATTTCGATCTGAACTCTCTCACCGTGCCTCGTCTCCGCTCGATC
CTTGTCAACCACGATGTTCCCTACCCTGCCTCTGCAAAGAAGGCTCAACTGATCGGCATCCTCGAAGATGAAGTT
CTTCCGCAAGCCAGAAAACTCTTGCGTGACCGCGACAGGGTTCGACGGACCAGTGCAGGTATTACAGATATGGGC
AGTCGGTCTACATCGGTGGCAAGCGACGTGAACGACAGAGAGTCGATGCCTCCTCCACCCACACCCTCAACAGTC
GGATCCACAAGCAGAAGCATGCGAGGCACATCGCGTCGCAGCACCCGTCACTCAACGGTAGATACAGATGATGGT
CTGGAACCTGCCACACCTATAAGGAACACAAAACGCACGAGCGTCGCTCGCTCGGTGGGTAAACACGCTCGCACA
TCTGACACGGAAACCGGCGACGACACACTCGCGACTCCAATCGCTGCTACCCGTCCTACGCCTCGCAAGTCTACA
GCTAGAAAAATCGGACGGAGCGAGATCCTCCCTTCGACAGAACTGGATGAACACACTCGTATTAAGTCAGAACCA
CGCAACGAGAGCATGTTTACGGATGATAATCCCTTTCAAAGTGGAAGCCCTGAGGCCCCTAAAAGCGCAAGGATG
AGTTATGATGGCAAGCGGAAGAGCGTTTCGCGCTTATCTACAGACAGTCCAGCTCGGGGTCGCGGACTCAGGTCG
CGGAAATCAGCAACCCCGTCCAACGTTCAGCAAGACGATGGCTTCCAGCCACCGAAGCGGGATTCGTTTGATTTC
GCCTCCCGGCTGATGCCTCCACAGGAGGAACCTGAGGAGGAATCGGATGAATCCGAGGATGATGAAGGGAGCGAA
ATTGGCGCAGGTGAAGAATTCACACCTGAGGAACAGCTCGCTATGTCTATGGAGGATGACCAGTACTCGCCACAA
ATTCAGGCTAGACGACGGCCCCAAAAGCAAAGCACTCTCAGCCGCTTGGCACCTTGGGTAGTCATCCTGTCACTG
GTCGGTAGTTTTGGTACCTGGTGGCGCAAAGAAAAACTCGAGATTGGATATTGCGGCCTAGGAAAGCCCACCTGG
TCTTTGGCAGACACTAAAGTTCCTGAATGGGCGAATGTGCTGGAGCCCCGGTGCGAGCCGTGCCCAAGCCACGCC
TTCTGCTACCCAGACTTTGTAGTCCGCTGCGAAAATGATTTCCTGTTGAAGCCGCATCCTCTCGCCCTCGGAGGC
CTAGTGCCGTTGCCGCCAACATGTGAACCTGATAGTGAAAAGGAACGCCGCGTGAAGGCCGTTGCTGATAAAGCT
GTTGAGGAGCTTCGTGAGCGCCGGGCAAAGTGGGAATGCGGTCAGCTAAAGGAAGACGGGAAGGGCGCCAGATCT
CCAGACATCAGCGAGCCAGAGTTGAGGGAAGAGGTGGCTAAGAAACGCCGCAAGGGCATGAGTGACACGGAATTT
GATGAGCTGTGGAAGGGCGCCATTGGGGAGATCCTTGAAAAAGATGAAGTTATTAGCAAGACCAAGCAGTAAGTT
TCCTTTGCCCTAGGATGGATTCTCGTGTCTCCTTGGCTATGCTCGAGGCTCTGGATTTCGACATCCAGCCGCATT
TCTTATAAAGATCTGGTCTGACCTTGTGTACCGGAACTGACAGAGGCGCGTTCGCAATCACAGAAATTCCGCCAT
CCTCATCCTCTCCTCCACCTCCATTGCACGGCTCCCACTCGCATGCGCCGTCCGCCGCTACTTCCGACTCACTCT
CCTCGCGTATCGACTCCCTATTTCACTTTTAATCATGACCATCGGTCTTCTTGTGTACGCTCGTGCGCGTGTCCT
CGCACGTCGGTCTGACATTGCTCGCGTGCCCGAATTGGTAGCTACAACCCTCGACCGACTATCCACGCAGGCTGC
ACTATACGCCCGCGGTGATGCCAAAGAACCTCATATTGCCATCGGGCAGCTCCGCGATGACGTTCTCCGCTTTGA
ACTCCAGGGCAAGCGTCGCGAGGAGCTCTGGCGACGGGTCCGCAGCTTTGTCGAAGGCAACGCCAACGTCCGCGC
TTCTGTGCGTGAAGGACGTAGCGGTGATGTTTCTCGGGTCTGGGAGTGGATCGGTGGGATTAACGCTGTCGGCGA
GCCGGAACATATTGGCCGCCGTGAGAGTGCACGATTCTCCGTCCCTTCTCCATCCGGTAATATTGTGACAAGCCC
TCAGACGCCTGCGAGTGAAAGCCAGCCCGAGCCTATTTCTAGCCCAAGAGAGTCTCGCCGCTGGGACGAGAGCCG
TCCGATCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail