Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5740.t1
Gene name
Locationscaffold_14:292097..292955
Strand+
Gene length (bp)858
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase 3.5E-51 74 231
PF02475 Met_10 Met-10+ like-protein 8.7E-10 74 194
PF03602 Cons_hypoth95 Conserved hypothetical protein 95 4.0E-07 70 155
PF01170 UPF0020 Putative RNA methylase family UPF0020 1.3E-05 96 178

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0009452 7-methylguanosine RNA capping Yes
GO:0001510 RNA methylation Yes
GO:0009987 cellular process No
GO:0036260 RNA capping No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009451 RNA modification No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043414 macromolecule methylation No
GO:0043170 macromolecule metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032259 methylation No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5740.t1
MADEDAPPEVHHYSSLHEVPWDIQNYWAQRYRIFSKYDDGVWLTDDAWFGVTPEPVANTIASQIAESAPAGRSIL
VDAFAGAGGNTIAFALTGKWKRIYAIEKNPAVLKCAKHNAKIYGVEDKITWFEGDCFEILKNQLKELAPYSLVFA
SPPWGGPGYRSDQVFNLKTMEPYSLQRLYDEYSAFSKHMVLYIPRTSDLAQIAKLVPDGNKATVMHYCMEGASKA
LCIFYGDFNVT*
Coding >Pro_DTO377G3_2|g5740.t1
ATGGCAGATGAAGACGCGCCTCCAGAGGTGCATCACTACAGCAGCTTGCATGAAGTGCCCTGGGACATCCAGAAC
TACTGGGCGCAACGCTATCGGATCTTTTCCAAGTACGATGATGGCGTATGGTTGACCGATGATGCTTGGTTTGGT
GTCACACCAGAACCAGTCGCAAACACTATAGCTTCGCAGATTGCCGAATCAGCGCCTGCTGGGCGCAGTATTCTC
GTGGACGCCTTCGCTGGCGCAGGAGGTAACACCATTGCATTTGCTTTGACCGGAAAATGGAAACGAATCTACGCG
ATCGAAAAAAACCCCGCTGTGCTGAAGTGCGCAAAGCATAATGCGAAAATCTATGGGGTGGAGGACAAGATCACT
TGGTTCGAAGGCGATTGTTTCGAGATTCTCAAGAATCAACTCAAAGAACTGGCGCCGTACAGTCTCGTCTTCGCC
AGCCCTCCCTGGGGAGGCCCGGGATATCGTTCAGATCAGGTATTCAACCTGAAAACCATGGAGCCATATTCCCTC
CAACGATTGTATGATGAATACTCAGCATTCAGCAAGCACATGGTCCTTTACATTCCAAGGACCTCTGATTTGGCA
CAAATTGCAAAACTGGTTCCTGACGGTAACAAGGCTACAGTAATGCACTATTGCATGGAGGGTGCAAGCAAGGCG
TTGTGTATTTTCTATGGGGATTTCAATGTGACATGA
Transcript >Pro_DTO377G3_2|g5740.t1
ATGGCAGATGAAGACGCGCCTCCAGAGGTGCATCACTACAGCAGCTTGCATGAAGTGCCCTGGGACATCCAGAAC
TACTGGGCGCAACGCTATCGGATCTTTTCCAAGTACGATGATGGCGTATGGTTGACCGATGATGCTTGGTTTGGT
GTCACACCAGAACCAGTCGCAAACACTATAGCTTCGCAGATTGCCGAATCAGCGCCTGCTGGGCGCAGTATTCTC
GTGGACGCCTTCGCTGGCGCAGGAGGTAACACCATTGCATTTGCTTTGACCGGAAAATGGAAACGAATCTACGCG
ATCGAAAAAAACCCCGCTGTGCTGAAGTGCGCAAAGCATAATGCGAAAATCTATGGGGTGGAGGACAAGATCACT
TGGTTCGAAGGCGATTGTTTCGAGATTCTCAAGAATCAACTCAAAGAACTGGCGCCGTACAGTCTCGTCTTCGCC
AGCCCTCCCTGGGGAGGCCCGGGATATCGTTCAGATCAGGTATTCAACCTGAAAACCATGGAGCCATATTCCCTC
CAACGATTGTATGATGAATACTCAGCATTCAGCAAGCACATGGTCCTTTACATTCCAAGGACCTCTGATTTGGCA
CAAATTGCAAAACTGGTTCCTGACGGTAACAAGGCTACAGTAATGCACTATTGCATGGAGGGTGCAAGCAAGGCG
TTGTGTATTTTCTATGGGGATTTCAATGTGACATGA
Gene >Pro_DTO377G3_2|g5740.t1
ATGGCAGATGAAGACGCGCCTCCAGAGGTGCATCACTACAGCAGCTTGCATGAAGTGCCCTGGGACATCCAGAAG
TAAGTGTCATCATCATTAAAAAACACCAATGCTAACCTAATTATCAGCTACTGGGCGCAACGCTATCGGATCTTT
TCCAAGTACGATGATGGCGTATGGTTGACCGATGATGCTTGGTTTGGTGTCACACCAGAACCAGTCGCAAAGTTT
GTGACTCTTTTCGATTATGCCAGAATTTCTGCTAATATTTGTTTAGCACTATAGCTTCGCAGATTGCCGAATCAG
CGCCTGCTGGGCGCAGTATTCTCGTGGACGCCTTCGCTGGCGCAGGAGGTAACACCATTGCATTTGCTTTGACCG
GAAAATGGAAACGAATCTACGCGATCGAAAAAAACCCCGCTGTGCTGAAGTGCGCAAAGCATAATGCGAAAATCT
ATGGGGTGGAGGACAAGATCACTTGGTTCGAAGGCGATTGTTTCGAGATTCTCAAGAATCAACTCAAAGAACTGG
CGCCGTACAGTCTCGTCTTCGCCAGCCCTCCCTGGGGAGGTAAGTGTCACCGAATCGTTACTTCTGCGACATGAA
CTGATTGTAGCAGGCCCGGGATATCGTTCAGATCAGGTATTCAACCTGAAAACCATGGAGCCATATTCCCTCCAA
CGATTGTATGATGAATACTCAGCATTCAGCAAGCACATGGTCCTTTACATTCCAAGGACCTCTGATTTGGCACAA
ATTGCAAAACTGGTTCCTGACGGTAACAAGGCTACAGTAATGCACTATTGCATGGAGGGTGCAAGCAAGGCGTTG
TGTATTTTCTATGGGGATTTCAATGTGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail