Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5730.t1
Gene name
Locationscaffold_14:268779..272329
Strand-
Gene length (bp)3550
Transcript length (bp)3501
Coding sequence length (bp)3501
Protein length (aa) 1167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00817 IMS impB/mucB/samB family 2.6E-43 378 540
PF16727 REV1_C DNA repair protein REV1 C-terminal domain 5.3E-22 1064 1163
PF11799 IMS_C impB/mucB/samB family C-terminal domain 6.5E-16 629 748
PF14377 UBM Ubiquitin binding region 4.9E-03 866 888
PF14377 UBM Ubiquitin binding region 7.9E-07 982 1012
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 5.4E-10 64 147
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 4.4E-05 64 136

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0003684 damaged DNA binding Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0033554 cellular response to stress No
GO:0006259 DNA metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003677 DNA binding No
GO:0003676 nucleic acid binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0097159 organic cyclic compound binding No
GO:0050896 response to stimulus No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.72 5.90 15.54
5d_25C Five days - 25 degrees Celsius 17.27 10.19 24.35
7d_25C Seven days - 25 degrees Celsius 16.24 9.52 22.97
10d_25C Ten days - 25 degrees Celsius 18.97 11.19 26.75
7d_15C Seven days - 15 degrees Celsius 15.89 9.22 22.56
7d_30C Seven days - 30 degrees Celsius 20.03 11.97 28.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.038386 yes
3d_25C 7d_25C 0.081239 no
3d_25C 7d_15C 0.103838 no
3d_25C 7d_30C 0.004045 yes
3d_25C 10d_25C 0.011062 yes
5d_25C 7d_25C 0.849847 no
5d_25C 7d_15C 0.791822 no
5d_25C 7d_30C 0.590729 no
5d_25C 10d_25C 0.758531 no
7d_25C 7d_15C 0.951749 no
7d_25C 7d_30C 0.407905 no
7d_25C 10d_25C 0.574542 no
7d_15C 7d_30C 0.366914 no
7d_15C 10d_25C 0.514323 no
7d_30C 10d_25C 0.871698 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5730.t1
MGSRHEINSSAVRKRIENHEFDDERGEEYEASSFGGFGDYMRRKKMKLQNLDAEIRASAGDCPPIFRGVVAHING
YTQPSLQELHRLIVSHGGGFLQYLDGKTAATHIIATALTPKKREEFRRYRIVKPTWVTDSIKAGRLLPWDEFRIV
DEGEAQRVLKFDNGRFISQTNSPRARYNDQSRSSRYSFQLRDMSTTEEGIGSSSKSVTSSIRSKASHMITPTMPS
QPSQSDYGDFPSFTMENEEEYHDPEHEQALASDIAQSIIPHQTPNSDQVPTSPDPLVDLESTTSPLDQTSPTKPA
LTSEEYNAQLLSDPRMQKSSVVNPEFLQQYYRESRLHHLSTWKAELKAQLQAATQENAQSQRLKKKPVPGSRRYI
LHVDFDSFFAAVSVLNHPELRGKPVAIAHGSGSGSEIASCNYPARARGVKNGMWMKAALQSCPDLKVLPYDFPAY
EEASRKFYTSILAIDGIVQSVSIDEALIDVTNLCVEAGGSDGKAISEGSTYREQAKADEIAQNLRDSIREKTGCE
VSVGIGNNILLAKVSLRKAKPAGQFQLKPDAVLDFIGDLTVRDLPGVGNSMAIKLEELNVKFVKDIRDLPRERLI
SGLGPKTGMKLWEYARGIDRTEVGDQTTRKSVSAEVNWGIRFVNQDQAEDFVRSLCEELNRRLTENLVKGKQLTL
KVMRRSLDAPLEPVKHLGHGKCDTFNKSVALGVATNVPEVIGKEAISMLRSFNFSPGDLRGLGVQMTKLESIKSG
PSGPESSQRQLNFQKSPPRQKVIPDADPDELESPQKDNSVRIQSDPILSDSAHKPLNISGTQFIMPTQTDPKVVA
ELPRDIRSRLVAQAKPRQGSRSGSPCPLPREARQPAQADLPPQSQLDPDALAALPEDVRQEVLGYYNHPAINAAS
PLVPVVPESRPSTSGSLKSRRPVSPPKKRRGRPPKSATIANKPKPKPLNQFSFGFVLPRPAAVSASLDEEALSRQ
ASPNVEEPTQPSAEFLAALPEDIRQELLEEQERTRMQQRSRATETTQRPPSRDQEAPPSAPIAVEKLLPLPPLPK
RPVFTSQRLSQLPDLRDAVGSWHEVFAAGGPYSEDVTSLCTYLSSVTLQEKDVDKAVSVVRWLMWLVGEHSQQQG
PKEPQGSRPEGTISWEEAIETMQNSVQVALEQRELPPVDFS*
Coding >Pro_DTO377G3_2|g5730.t1
ATGGGCTCCCGTCATGAGATCAACTCTAGTGCAGTGCGCAAACGCATTGAAAATCATGAATTTGACGATGAAAGA
GGAGAGGAGTATGAGGCCTCCAGCTTCGGCGGGTTTGGGGACTACATGCGCCGGAAAAAGATGAAGTTGCAGAAT
CTTGACGCAGAAATTCGAGCATCAGCTGGTGATTGCCCGCCAATATTCCGTGGTGTGGTTGCCCATATCAATGGG
TACACTCAACCTTCCCTGCAAGAGCTGCACCGTTTGATTGTCAGCCATGGGGGTGGCTTCCTTCAATATCTGGAT
GGCAAGACAGCAGCTACTCATATCATTGCCACTGCTCTGACCCCCAAGAAGCGTGAAGAGTTCCGCCGCTACCGC
ATAGTGAAACCTACGTGGGTGACAGACAGTATCAAAGCAGGACGTCTGCTGCCATGGGATGAATTTAGAATAGTA
GACGAGGGTGAAGCGCAAAGAGTGCTCAAGTTTGATAATGGCCGGTTTATCAGCCAGACGAATAGCCCTCGCGCA
CGTTACAATGACCAATCGAGGTCTAGCAGGTATAGCTTTCAGCTCAGAGATATGAGCACAACAGAAGAAGGGATC
GGCTCTTCATCGAAGTCCGTGACTTCATCTATTCGGTCGAAAGCCTCACATATGATCACACCAACCATGCCGAGC
CAGCCATCTCAGTCGGACTATGGCGACTTCCCTAGCTTCACTATGGAGAACGAGGAGGAATATCATGACCCTGAG
CACGAACAAGCTCTAGCCAGTGACATAGCACAATCTATAATACCACATCAAACTCCCAATTCAGATCAAGTGCCC
ACTTCACCAGATCCACTGGTTGACCTCGAATCAACAACCTCGCCTCTCGACCAAACAAGTCCAACAAAACCCGCT
TTAACTTCTGAAGAATACAATGCGCAGCTCCTGTCCGACCCAAGGATGCAGAAGTCATCTGTTGTCAATCCAGAA
TTCCTGCAGCAGTATTATAGGGAGTCTCGCCTGCATCATCTGTCAACCTGGAAGGCGGAGCTGAAAGCCCAACTG
CAGGCCGCAACGCAAGAAAATGCACAGTCTCAGAGATTGAAAAAGAAACCTGTGCCTGGATCAAGACGGTACATT
CTACACGTGGACTTCGACTCATTCTTTGCAGCTGTCTCAGTTCTAAATCATCCCGAGCTCCGGGGAAAGCCTGTT
GCTATCGCCCATGGCTCTGGATCAGGCTCCGAGATTGCTAGTTGTAATTATCCTGCACGTGCTCGCGGCGTCAAG
AATGGGATGTGGATGAAAGCTGCTTTGCAATCATGCCCCGATCTCAAAGTCCTACCTTATGATTTCCCTGCCTAT
GAAGAGGCGAGTCGCAAGTTCTACACCTCGATACTTGCCATCGATGGTATCGTGCAAAGTGTCAGTATCGACGAG
GCTTTGATCGATGTCACAAATTTATGCGTGGAAGCAGGCGGCTCAGACGGAAAGGCTATATCAGAAGGATCAACC
TATCGCGAGCAAGCCAAAGCGGATGAAATTGCGCAAAATTTACGCGATTCAATCAGAGAGAAGACCGGATGTGAA
GTCTCTGTCGGAATTGGCAACAATATTCTTCTCGCAAAAGTGTCTCTTAGAAAGGCCAAGCCTGCTGGACAGTTC
CAATTAAAGCCAGATGCTGTTTTGGACTTCATTGGAGATCTCACTGTTCGTGATCTTCCCGGAGTGGGTAATAGC
ATGGCAATTAAACTGGAAGAACTGAACGTCAAGTTTGTCAAAGACATCCGAGATCTCCCGAGAGAGAGACTAATA
TCTGGTCTGGGACCCAAAACTGGAATGAAATTGTGGGAATACGCCCGAGGAATCGACAGAACAGAAGTTGGCGAT
CAAACCACGAGGAAATCTGTTTCGGCCGAGGTCAACTGGGGGATTCGATTTGTCAATCAGGACCAAGCAGAGGAC
TTTGTGCGTTCTCTGTGCGAGGAGCTGAATCGAAGATTGACGGAAAATCTAGTGAAGGGGAAACAGCTCACTTTA
AAGGTCATGCGTCGATCGCTAGACGCTCCACTAGAACCCGTCAAGCATCTCGGCCATGGAAAGTGTGATACATTC
AACAAGAGCGTCGCTCTTGGTGTCGCGACCAATGTTCCAGAAGTCATTGGGAAAGAAGCAATATCGATGTTGAGA
AGTTTCAATTTTTCACCTGGAGACTTGAGAGGTCTGGGTGTGCAAATGACCAAACTTGAATCAATCAAATCTGGC
CCTTCAGGCCCCGAGAGCAGCCAGCGACAACTCAACTTCCAGAAGTCTCCGCCTCGCCAGAAAGTCATTCCAGAT
GCGGACCCTGACGAGCTAGAGAGTCCGCAAAAAGATAACTCTGTTCGTATTCAATCAGATCCAATACTCAGCGAT
AGTGCCCACAAGCCACTCAATATCTCGGGGACCCAATTTATTATGCCCACCCAAACGGATCCCAAAGTCGTTGCC
GAGTTGCCTAGGGATATCAGATCAAGGCTTGTTGCACAAGCAAAGCCGCGCCAGGGTTCTCGCTCAGGGTCTCCA
TGTCCTCTTCCCCGTGAAGCACGACAACCTGCCCAAGCAGACCTCCCCCCTCAGTCTCAGCTGGACCCAGATGCA
TTGGCGGCATTGCCTGAAGATGTCCGCCAAGAAGTATTGGGTTATTATAACCACCCAGCTATCAACGCTGCGTCA
CCGCTCGTGCCGGTAGTACCAGAGTCGCGCCCATCAACATCTGGTTCTCTCAAGTCGAGAAGGCCAGTCTCACCA
CCCAAGAAAAGACGTGGCCGCCCGCCGAAGTCGGCAACGATTGCGAACAAGCCTAAGCCTAAGCCTCTAAACCAA
TTTAGCTTTGGGTTCGTTCTTCCACGCCCAGCAGCTGTATCTGCTAGTCTGGACGAAGAGGCTTTGTCTAGACAA
GCGTCACCAAATGTTGAAGAGCCAACCCAACCTTCGGCTGAATTCCTTGCTGCTTTACCTGAAGATATCAGACAA
GAGCTTCTTGAAGAACAAGAACGCACCCGCATGCAACAGCGCTCGCGAGCTACTGAAACCACACAAAGACCTCCA
TCTAGGGATCAGGAGGCTCCTCCTTCTGCGCCAATTGCCGTAGAGAAACTTCTACCTTTACCACCTCTCCCCAAG
CGTCCCGTCTTTACATCACAACGTCTGTCCCAATTACCAGATCTACGAGATGCTGTTGGCTCATGGCATGAAGTC
TTTGCAGCTGGCGGTCCGTACAGCGAAGACGTTACTTCACTATGTACATACCTGTCCAGCGTGACATTGCAAGAG
AAAGATGTGGATAAGGCTGTTTCAGTGGTGCGCTGGTTGATGTGGTTGGTCGGTGAGCATTCGCAGCAGCAGGGG
CCTAAAGAGCCACAGGGGTCTCGGCCCGAGGGAACTATAAGCTGGGAAGAGGCTATAGAGACCATGCAGAATAGT
GTCCAGGTGGCTCTGGAACAAAGAGAGCTTCCCCCGGTGGACTTTTCGTAA
Transcript >Pro_DTO377G3_2|g5730.t1
ATGGGCTCCCGTCATGAGATCAACTCTAGTGCAGTGCGCAAACGCATTGAAAATCATGAATTTGACGATGAAAGA
GGAGAGGAGTATGAGGCCTCCAGCTTCGGCGGGTTTGGGGACTACATGCGCCGGAAAAAGATGAAGTTGCAGAAT
CTTGACGCAGAAATTCGAGCATCAGCTGGTGATTGCCCGCCAATATTCCGTGGTGTGGTTGCCCATATCAATGGG
TACACTCAACCTTCCCTGCAAGAGCTGCACCGTTTGATTGTCAGCCATGGGGGTGGCTTCCTTCAATATCTGGAT
GGCAAGACAGCAGCTACTCATATCATTGCCACTGCTCTGACCCCCAAGAAGCGTGAAGAGTTCCGCCGCTACCGC
ATAGTGAAACCTACGTGGGTGACAGACAGTATCAAAGCAGGACGTCTGCTGCCATGGGATGAATTTAGAATAGTA
GACGAGGGTGAAGCGCAAAGAGTGCTCAAGTTTGATAATGGCCGGTTTATCAGCCAGACGAATAGCCCTCGCGCA
CGTTACAATGACCAATCGAGGTCTAGCAGGTATAGCTTTCAGCTCAGAGATATGAGCACAACAGAAGAAGGGATC
GGCTCTTCATCGAAGTCCGTGACTTCATCTATTCGGTCGAAAGCCTCACATATGATCACACCAACCATGCCGAGC
CAGCCATCTCAGTCGGACTATGGCGACTTCCCTAGCTTCACTATGGAGAACGAGGAGGAATATCATGACCCTGAG
CACGAACAAGCTCTAGCCAGTGACATAGCACAATCTATAATACCACATCAAACTCCCAATTCAGATCAAGTGCCC
ACTTCACCAGATCCACTGGTTGACCTCGAATCAACAACCTCGCCTCTCGACCAAACAAGTCCAACAAAACCCGCT
TTAACTTCTGAAGAATACAATGCGCAGCTCCTGTCCGACCCAAGGATGCAGAAGTCATCTGTTGTCAATCCAGAA
TTCCTGCAGCAGTATTATAGGGAGTCTCGCCTGCATCATCTGTCAACCTGGAAGGCGGAGCTGAAAGCCCAACTG
CAGGCCGCAACGCAAGAAAATGCACAGTCTCAGAGATTGAAAAAGAAACCTGTGCCTGGATCAAGACGGTACATT
CTACACGTGGACTTCGACTCATTCTTTGCAGCTGTCTCAGTTCTAAATCATCCCGAGCTCCGGGGAAAGCCTGTT
GCTATCGCCCATGGCTCTGGATCAGGCTCCGAGATTGCTAGTTGTAATTATCCTGCACGTGCTCGCGGCGTCAAG
AATGGGATGTGGATGAAAGCTGCTTTGCAATCATGCCCCGATCTCAAAGTCCTACCTTATGATTTCCCTGCCTAT
GAAGAGGCGAGTCGCAAGTTCTACACCTCGATACTTGCCATCGATGGTATCGTGCAAAGTGTCAGTATCGACGAG
GCTTTGATCGATGTCACAAATTTATGCGTGGAAGCAGGCGGCTCAGACGGAAAGGCTATATCAGAAGGATCAACC
TATCGCGAGCAAGCCAAAGCGGATGAAATTGCGCAAAATTTACGCGATTCAATCAGAGAGAAGACCGGATGTGAA
GTCTCTGTCGGAATTGGCAACAATATTCTTCTCGCAAAAGTGTCTCTTAGAAAGGCCAAGCCTGCTGGACAGTTC
CAATTAAAGCCAGATGCTGTTTTGGACTTCATTGGAGATCTCACTGTTCGTGATCTTCCCGGAGTGGGTAATAGC
ATGGCAATTAAACTGGAAGAACTGAACGTCAAGTTTGTCAAAGACATCCGAGATCTCCCGAGAGAGAGACTAATA
TCTGGTCTGGGACCCAAAACTGGAATGAAATTGTGGGAATACGCCCGAGGAATCGACAGAACAGAAGTTGGCGAT
CAAACCACGAGGAAATCTGTTTCGGCCGAGGTCAACTGGGGGATTCGATTTGTCAATCAGGACCAAGCAGAGGAC
TTTGTGCGTTCTCTGTGCGAGGAGCTGAATCGAAGATTGACGGAAAATCTAGTGAAGGGGAAACAGCTCACTTTA
AAGGTCATGCGTCGATCGCTAGACGCTCCACTAGAACCCGTCAAGCATCTCGGCCATGGAAAGTGTGATACATTC
AACAAGAGCGTCGCTCTTGGTGTCGCGACCAATGTTCCAGAAGTCATTGGGAAAGAAGCAATATCGATGTTGAGA
AGTTTCAATTTTTCACCTGGAGACTTGAGAGGTCTGGGTGTGCAAATGACCAAACTTGAATCAATCAAATCTGGC
CCTTCAGGCCCCGAGAGCAGCCAGCGACAACTCAACTTCCAGAAGTCTCCGCCTCGCCAGAAAGTCATTCCAGAT
GCGGACCCTGACGAGCTAGAGAGTCCGCAAAAAGATAACTCTGTTCGTATTCAATCAGATCCAATACTCAGCGAT
AGTGCCCACAAGCCACTCAATATCTCGGGGACCCAATTTATTATGCCCACCCAAACGGATCCCAAAGTCGTTGCC
GAGTTGCCTAGGGATATCAGATCAAGGCTTGTTGCACAAGCAAAGCCGCGCCAGGGTTCTCGCTCAGGGTCTCCA
TGTCCTCTTCCCCGTGAAGCACGACAACCTGCCCAAGCAGACCTCCCCCCTCAGTCTCAGCTGGACCCAGATGCA
TTGGCGGCATTGCCTGAAGATGTCCGCCAAGAAGTATTGGGTTATTATAACCACCCAGCTATCAACGCTGCGTCA
CCGCTCGTGCCGGTAGTACCAGAGTCGCGCCCATCAACATCTGGTTCTCTCAAGTCGAGAAGGCCAGTCTCACCA
CCCAAGAAAAGACGTGGCCGCCCGCCGAAGTCGGCAACGATTGCGAACAAGCCTAAGCCTAAGCCTCTAAACCAA
TTTAGCTTTGGGTTCGTTCTTCCACGCCCAGCAGCTGTATCTGCTAGTCTGGACGAAGAGGCTTTGTCTAGACAA
GCGTCACCAAATGTTGAAGAGCCAACCCAACCTTCGGCTGAATTCCTTGCTGCTTTACCTGAAGATATCAGACAA
GAGCTTCTTGAAGAACAAGAACGCACCCGCATGCAACAGCGCTCGCGAGCTACTGAAACCACACAAAGACCTCCA
TCTAGGGATCAGGAGGCTCCTCCTTCTGCGCCAATTGCCGTAGAGAAACTTCTACCTTTACCACCTCTCCCCAAG
CGTCCCGTCTTTACATCACAACGTCTGTCCCAATTACCAGATCTACGAGATGCTGTTGGCTCATGGCATGAAGTC
TTTGCAGCTGGCGGTCCGTACAGCGAAGACGTTACTTCACTATGTACATACCTGTCCAGCGTGACATTGCAAGAG
AAAGATGTGGATAAGGCTGTTTCAGTGGTGCGCTGGTTGATGTGGTTGGTCGGTGAGCATTCGCAGCAGCAGGGG
CCTAAAGAGCCACAGGGGTCTCGGCCCGAGGGAACTATAAGCTGGGAAGAGGCTATAGAGACCATGCAGAATAGT
GTCCAGGTGGCTCTGGAACAAAGAGAGCTTCCCCCGGTGGACTTTTCGTAA
Gene >Pro_DTO377G3_2|g5730.t1
ATGGGCTCCCGTCATGAGATCAACTCTAGTGCAGTGCGCAAACGCATTGAAAATCGTACGTTTAGTCTAAATATC
AATTTCCACTTTTATCTGACCATGTCTAGATGAATTTGACGATGAAAGAGGAGAGGAGTATGAGGCCTCCAGCTT
CGGCGGGTTTGGGGACTACATGCGCCGGAAAAAGATGAAGTTGCAGAATCTTGACGCAGAAATTCGAGCATCAGC
TGGTGATTGCCCGCCAATATTCCGTGGTGTGGTTGCCCATATCAATGGGTACACTCAACCTTCCCTGCAAGAGCT
GCACCGTTTGATTGTCAGCCATGGGGGTGGCTTCCTTCAATATCTGGATGGCAAGACAGCAGCTACTCATATCAT
TGCCACTGCTCTGACCCCCAAGAAGCGTGAAGAGTTCCGCCGCTACCGCATAGTGAAACCTACGTGGGTGACAGA
CAGTATCAAAGCAGGACGTCTGCTGCCATGGGATGAATTTAGAATAGTAGACGAGGGTGAAGCGCAAAGAGTGCT
CAAGTTTGATAATGGCCGGTTTATCAGCCAGACGAATAGCCCTCGCGCACGTTACAATGACCAATCGAGGTCTAG
CAGGTATAGCTTTCAGCTCAGAGATATGAGCACAACAGAAGAAGGGATCGGCTCTTCATCGAAGTCCGTGACTTC
ATCTATTCGGTCGAAAGCCTCACATATGATCACACCAACCATGCCGAGCCAGCCATCTCAGTCGGACTATGGCGA
CTTCCCTAGCTTCACTATGGAGAACGAGGAGGAATATCATGACCCTGAGCACGAACAAGCTCTAGCCAGTGACAT
AGCACAATCTATAATACCACATCAAACTCCCAATTCAGATCAAGTGCCCACTTCACCAGATCCACTGGTTGACCT
CGAATCAACAACCTCGCCTCTCGACCAAACAAGTCCAACAAAACCCGCTTTAACTTCTGAAGAATACAATGCGCA
GCTCCTGTCCGACCCAAGGATGCAGAAGTCATCTGTTGTCAATCCAGAATTCCTGCAGCAGTATTATAGGGAGTC
TCGCCTGCATCATCTGTCAACCTGGAAGGCGGAGCTGAAAGCCCAACTGCAGGCCGCAACGCAAGAAAATGCACA
GTCTCAGAGATTGAAAAAGAAACCTGTGCCTGGATCAAGACGGTACATTCTACACGTGGACTTCGACTCATTCTT
TGCAGCTGTCTCAGTTCTAAATCATCCCGAGCTCCGGGGAAAGCCTGTTGCTATCGCCCATGGCTCTGGATCAGG
CTCCGAGATTGCTAGTTGTAATTATCCTGCACGTGCTCGCGGCGTCAAGAATGGGATGTGGATGAAAGCTGCTTT
GCAATCATGCCCCGATCTCAAAGTCCTACCTTATGATTTCCCTGCCTATGAAGAGGCGAGTCGCAAGTTCTACAC
CTCGATACTTGCCATCGATGGTATCGTGCAAAGTGTCAGTATCGACGAGGCTTTGATCGATGTCACAAATTTATG
CGTGGAAGCAGGCGGCTCAGACGGAAAGGCTATATCAGAAGGATCAACCTATCGCGAGCAAGCCAAAGCGGATGA
AATTGCGCAAAATTTACGCGATTCAATCAGAGAGAAGACCGGATGTGAAGTCTCTGTCGGAATTGGCAACAATAT
TCTTCTCGCAAAAGTGTCTCTTAGAAAGGCCAAGCCTGCTGGACAGTTCCAATTAAAGCCAGATGCTGTTTTGGA
CTTCATTGGAGATCTCACTGTTCGTGATCTTCCCGGAGTGGGTAATAGCATGGCAATTAAACTGGAAGAACTGAA
CGTCAAGTTTGTCAAAGACATCCGAGATCTCCCGAGAGAGAGACTAATATCTGGTCTGGGACCCAAAACTGGAAT
GAAATTGTGGGAATACGCCCGAGGAATCGACAGAACAGAAGTTGGCGATCAAACCACGAGGAAATCTGTTTCGGC
CGAGGTCAACTGGGGGATTCGATTTGTCAATCAGGACCAAGCAGAGGACTTTGTGCGTTCTCTGTGCGAGGAGCT
GAATCGAAGATTGACGGAAAATCTAGTGAAGGGGAAACAGCTCACTTTAAAGGTCATGCGTCGATCGCTAGACGC
TCCACTAGAACCCGTCAAGCATCTCGGCCATGGAAAGTGTGATACATTCAACAAGAGCGTCGCTCTTGGTGTCGC
GACCAATGTTCCAGAAGTCATTGGGAAAGAAGCAATATCGATGTTGAGAAGTTTCAATTTTTCACCTGGAGACTT
GAGAGGTCTGGGTGTGCAAATGACCAAACTTGAATCAATCAAATCTGGCCCTTCAGGCCCCGAGAGCAGCCAGCG
ACAACTCAACTTCCAGAAGTCTCCGCCTCGCCAGAAAGTCATTCCAGATGCGGACCCTGACGAGCTAGAGAGTCC
GCAAAAAGATAACTCTGTTCGTATTCAATCAGATCCAATACTCAGCGATAGTGCCCACAAGCCACTCAATATCTC
GGGGACCCAATTTATTATGCCCACCCAAACGGATCCCAAAGTCGTTGCCGAGTTGCCTAGGGATATCAGATCAAG
GCTTGTTGCACAAGCAAAGCCGCGCCAGGGTTCTCGCTCAGGGTCTCCATGTCCTCTTCCCCGTGAAGCACGACA
ACCTGCCCAAGCAGACCTCCCCCCTCAGTCTCAGCTGGACCCAGATGCATTGGCGGCATTGCCTGAAGATGTCCG
CCAAGAAGTATTGGGTTATTATAACCACCCAGCTATCAACGCTGCGTCACCGCTCGTGCCGGTAGTACCAGAGTC
GCGCCCATCAACATCTGGTTCTCTCAAGTCGAGAAGGCCAGTCTCACCACCCAAGAAAAGACGTGGCCGCCCGCC
GAAGTCGGCAACGATTGCGAACAAGCCTAAGCCTAAGCCTCTAAACCAATTTAGCTTTGGGTTCGTTCTTCCACG
CCCAGCAGCTGTATCTGCTAGTCTGGACGAAGAGGCTTTGTCTAGACAAGCGTCACCAAATGTTGAAGAGCCAAC
CCAACCTTCGGCTGAATTCCTTGCTGCTTTACCTGAAGATATCAGACAAGAGCTTCTTGAAGAACAAGAACGCAC
CCGCATGCAACAGCGCTCGCGAGCTACTGAAACCACACAAAGACCTCCATCTAGGGATCAGGAGGCTCCTCCTTC
TGCGCCAATTGCCGTAGAGAAACTTCTACCTTTACCACCTCTCCCCAAGCGTCCCGTCTTTACATCACAACGTCT
GTCCCAATTACCAGATCTACGAGATGCTGTTGGCTCATGGCATGAAGTCTTTGCAGCTGGCGGTCCGTACAGCGA
AGACGTTACTTCACTATGTACATACCTGTCCAGCGTGACATTGCAAGAGAAAGATGTGGATAAGGCTGTTTCAGT
GGTGCGCTGGTTGATGTGGTTGGTCGGTGAGCATTCGCAGCAGCAGGGGCCTAAAGAGCCACAGGGGTCTCGGCC
CGAGGGAACTATAAGCTGGGAAGAGGCTATAGAGACCATGCAGAATAGTGTCCAGGTGGCTCTGGAACAAAGAGA
GCTTCCCCCGGTGGACTTTTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail