Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g573.t1
Gene name
Locationscaffold_01:1482966..1484579
Strand-
Gene length (bp)1613
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 141 158 17
2 228 250 22
3 271 293 22
4 308 330 22
5 339 361 22
6 391 413 22
7 446 468 22
8 478 500 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g573.t1
MTIGDASHKFEPLTGQGGNNAMETAASLTNHLVAALKNSQSGTLSSAEISKIFEGVQQQREKRAWGLIKVSHARQ
RLECLETPFLKFIARYVVPRFSKSTVLSKWIDTYSPAVSLDMLPLPHRPREIAYFDERSRTPSSRGVVSILLYAA
YFLLAWLGHRQLSAAIRANGTMGFVRQSIQNQSVQLPGGIEAPLRQVYTGIRPVDLILKVMVAIFLPAVSNFSKP
EQPFQVLYFLGSMMPIIAIWTVEGFRPRNKWTLLAIPSLWAVLYQLRGIGLIAPLFFISSTYVSSGIAYFSPSTR
TLPESTARAILPALILGFVVPTMMLFFPLADAPNTRQVFIVLWQPAPVYVLILTHIFSRVIKSISSSTPAKTDSS
AAESKPNRDIPLLQTLYAVAGGVSACFHVALLLSWAALGTGFITRAFIPSDAFAQVATLADGVFVFFQNDFLLVS
AATLLWCLASVWDLYRIGVSNVSWQVALAGLILGSVAIGPGATVAAVWYWREEVMSRTSFRRHGLGL*
Coding >Pro_DTO377G3_2|g573.t1
ATGACTATCGGCGATGCCAGTCACAAGTTTGAGCCGTTGACAGGCCAGGGAGGCAATAATGCAATGGAAACCGCC
GCGTCCCTGACCAATCATCTCGTTGCGGCCTTGAAAAACAGCCAGTCAGGCACCCTGTCATCAGCAGAAATTTCC
AAAATCTTTGAGGGCGTTCAACAGCAGCGTGAAAAACGTGCATGGGGATTGATCAAAGTATCCCATGCCCGGCAA
CGTCTGGAGTGCCTGGAAACGCCCTTTTTGAAGTTCATAGCAAGATACGTGGTGCCACGCTTCTCCAAATCCACT
GTCCTCAGCAAATGGATCGACACGTATTCTCCCGCAGTGTCCTTGGACATGCTTCCACTGCCGCACAGGCCTCGA
GAAATTGCATATTTCGACGAGCGTTCTAGAACACCGTCATCTCGGGGTGTGGTGAGCATCTTGTTGTACGCTGCA
TACTTCCTCCTAGCCTGGTTAGGCCATCGTCAATTGTCGGCAGCAATCAGAGCAAATGGAACAATGGGGTTCGTC
CGCCAGTCAATCCAGAACCAGTCGGTTCAACTCCCGGGAGGAATCGAAGCTCCCCTTCGCCAGGTGTACACAGGA
ATCCGACCTGTTGACCTCATTTTGAAAGTCATGGTGGCTATATTCCTGCCAGCGGTCTCCAACTTCTCAAAGCCG
GAGCAGCCATTCCAAGTTCTGTACTTCCTAGGCTCGATGATGCCGATTATCGCTATCTGGACGGTTGAAGGTTTC
CGACCAAGGAACAAATGGACCCTTCTTGCCATTCCGAGCCTGTGGGCGGTTCTATACCAGTTGCGAGGGATAGGG
TTGATTGCACCGCTCTTCTTCATATCAAGCACATATGTTTCTTCGGGGATAGCATACTTTTCCCCAAGTACCCGC
ACACTTCCCGAATCCACCGCTCGAGCGATACTGCCAGCATTGATTTTGGGATTCGTCGTGCCTACCATGATGCTG
TTCTTCCCATTGGCTGATGCCCCGAACACGCGACAGGTCTTCATTGTGCTGTGGCAGCCTGCTCCGGTATACGTG
CTTATCTTGACTCACATATTCTCCCGCGTCATCAAATCGATCAGTTCAAGCACACCGGCCAAGACCGATAGCTCC
GCAGCGGAGAGCAAACCAAACCGTGACATCCCACTCTTGCAAACCCTCTACGCTGTGGCCGGTGGTGTATCTGCT
TGTTTCCATGTGGCCTTGTTGCTGAGCTGGGCTGCTTTGGGGACAGGTTTTATTACAAGGGCCTTCATCCCATCC
GATGCCTTCGCACAGGTGGCAACACTTGCGGACGGTGTCTTCGTGTTTTTCCAGAACGATTTCCTCCTTGTTTCG
GCGGCAACTCTCCTGTGGTGTCTGGCTAGCGTGTGGGATCTGTACCGCATTGGAGTGTCTAATGTCTCCTGGCAA
GTGGCACTGGCTGGTTTGATTCTAGGTTCCGTGGCAATTGGACCGGGTGCGACTGTGGCGGCTGTATGGTATTGG
CGGGAGGAGGTCATGAGTCGGACATCTTTTCGCCGGCATGGTCTGGGGCTCTAG
Transcript >Pro_DTO377G3_2|g573.t1
ATGACTATCGGCGATGCCAGTCACAAGTTTGAGCCGTTGACAGGCCAGGGAGGCAATAATGCAATGGAAACCGCC
GCGTCCCTGACCAATCATCTCGTTGCGGCCTTGAAAAACAGCCAGTCAGGCACCCTGTCATCAGCAGAAATTTCC
AAAATCTTTGAGGGCGTTCAACAGCAGCGTGAAAAACGTGCATGGGGATTGATCAAAGTATCCCATGCCCGGCAA
CGTCTGGAGTGCCTGGAAACGCCCTTTTTGAAGTTCATAGCAAGATACGTGGTGCCACGCTTCTCCAAATCCACT
GTCCTCAGCAAATGGATCGACACGTATTCTCCCGCAGTGTCCTTGGACATGCTTCCACTGCCGCACAGGCCTCGA
GAAATTGCATATTTCGACGAGCGTTCTAGAACACCGTCATCTCGGGGTGTGGTGAGCATCTTGTTGTACGCTGCA
TACTTCCTCCTAGCCTGGTTAGGCCATCGTCAATTGTCGGCAGCAATCAGAGCAAATGGAACAATGGGGTTCGTC
CGCCAGTCAATCCAGAACCAGTCGGTTCAACTCCCGGGAGGAATCGAAGCTCCCCTTCGCCAGGTGTACACAGGA
ATCCGACCTGTTGACCTCATTTTGAAAGTCATGGTGGCTATATTCCTGCCAGCGGTCTCCAACTTCTCAAAGCCG
GAGCAGCCATTCCAAGTTCTGTACTTCCTAGGCTCGATGATGCCGATTATCGCTATCTGGACGGTTGAAGGTTTC
CGACCAAGGAACAAATGGACCCTTCTTGCCATTCCGAGCCTGTGGGCGGTTCTATACCAGTTGCGAGGGATAGGG
TTGATTGCACCGCTCTTCTTCATATCAAGCACATATGTTTCTTCGGGGATAGCATACTTTTCCCCAAGTACCCGC
ACACTTCCCGAATCCACCGCTCGAGCGATACTGCCAGCATTGATTTTGGGATTCGTCGTGCCTACCATGATGCTG
TTCTTCCCATTGGCTGATGCCCCGAACACGCGACAGGTCTTCATTGTGCTGTGGCAGCCTGCTCCGGTATACGTG
CTTATCTTGACTCACATATTCTCCCGCGTCATCAAATCGATCAGTTCAAGCACACCGGCCAAGACCGATAGCTCC
GCAGCGGAGAGCAAACCAAACCGTGACATCCCACTCTTGCAAACCCTCTACGCTGTGGCCGGTGGTGTATCTGCT
TGTTTCCATGTGGCCTTGTTGCTGAGCTGGGCTGCTTTGGGGACAGGTTTTATTACAAGGGCCTTCATCCCATCC
GATGCCTTCGCACAGGTGGCAACACTTGCGGACGGTGTCTTCGTGTTTTTCCAGAACGATTTCCTCCTTGTTTCG
GCGGCAACTCTCCTGTGGTGTCTGGCTAGCGTGTGGGATCTGTACCGCATTGGAGTGTCTAATGTCTCCTGGCAA
GTGGCACTGGCTGGTTTGATTCTAGGTTCCGTGGCAATTGGACCGGGTGCGACTGTGGCGGCTGTATGGTATTGG
CGGGAGGAGGTCATGAGTCGGACATCTTTTCGCCGGCATGGTCTGGGGCTCTAG
Gene >Pro_DTO377G3_2|g573.t1
ATGACTATCGGCGATGCCAGTCACAAGGTGAGACTACCTATCTCCGAAAATATCATACGAAGACTAACAATATCC
CCGTCCAATAGTTTGAGCCGTTGACAGGCCAGGGAGGCAATAATGCAATGGAAACCGCCGCGTCCCTGACCAATC
ATCTCGTTGCGGCCTTGAAAAACAGCCAGTCAGGCACCCTGTCATCAGCAGAAATTTCCAAAATCTTTGAGGGCG
TTCAACAGCAGCGTGAAAAACGTGCATGGGGATTGATCAAAGTATCCCATGCCCGGCAACGTCTGGAGTGCCTGG
AAACGCCCTTTTTGAAGTTCATAGCAAGATACGTGGTGCCACGCTTCTCCAAATCCACTGTCCTCAGCAAATGGA
TCGACACGTATTCTCCCGCAGTGTCCTTGGACATGCTTCCACTGCCGCACAGGCCTCGAGAAATTGCATATTTCG
ACGAGCGTTCTAGAACACCGTCATCTCGGGGTGTGGTGAGCATCTTGTTGTACGCTGCATACTTCCTCCTAGCCT
GGTTAGGCCATCGTCAATTGTCGGCAGCAATCAGAGCAAATGGAACAATGGGGTTCGTCCGCCAGTCAATCCAGA
ACCAGTCGGTTCAACTCCCGGGAGGAATCGAAGCTCCCCTTCGCCAGGTGTACACAGGAATCCGACCTGTTGACC
TCATTTTGAAAGTCATGGTGGCTATATTCCTGCCAGCGGTCTCCAACTTCTCAAAGCCGGAGCAGCCATTCCAAG
TTCTGTACTTCCTAGGCTCGATGATGCCGATTATCGCTATCTGGACGGTTGAAGGTTTCCGACCAAGGAACAAAT
GGACCCTTCTTGCCATTCCGAGCCTGTGGGCGGTTCTATACCAGTTGCGAGGGATAGGGTTGATTGCACCGCTCT
TCTTCATATCAAGCACATATGTTTCTTCGGGGATAGCATACTTTTCCCCAAGTACCCGCACACTTCCCGAATCCA
CCGCTCGAGCGATACTGCCAGCATTGATTTTGGGATTCGTCGTGCCTACCATGATGCTGTTCTTCCCATTGGCTG
ATGCCCCGAACACGCGACAGGTCTTCATTGTGCTGTGGCAGCCTGCTCCGGTATACGTGCTTATCTTGACTCACA
TATTCTCCCGCGTCATCAAATCGATCAGTTCAAGCACACCGGCCAAGACCGATAGCTCCGCAGCGGAGAGCAAAC
CAAACCGTGACATCCCACTCTTGCAAACCCTCTACGCTGTGGCCGGTGGTGTATCTGCTTGTTTCCATGTGGCCT
TGTTGCTGAGCTGGGCTGCTTTGGGGACAGGTTTTATTACAAGGGCCTTCATCCCATCCGATGCCTTCGCACAGG
TGGCAACACTTGCGGACGGTGTCTTCGTGTTTTTCCAGAACGATTTCCTCCTTGTTTCGGCGGCAACTCTCCTGT
GGTGTCTGGCTAGCGTGTGGGATCTGTACCGCATTGGAGTGTCTAATGTCTCCTGGCAAGTGGCACTGGCTGGTT
TGATTCTAGGTTCCGTGGCAATTGGACCGGGTGCGACTGTGGCGGCTGTATGGTATTGGCGGGAGGAGGTCATGA
GTCGGACATCTTTTCGCCGGCATGGTCTGGGGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail