Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5713.t1
Gene name
Locationscaffold_14:221503..224108
Strand+
Gene length (bp)2605
Transcript length (bp)2379
Coding sequence length (bp)2379
Protein length (aa) 793

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 3.0E-168 82 762

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 87 106 19
2 111 133 22
3 153 175 22
4 190 212 22
5 245 267 22
6 322 344 22
7 398 420 22
8 482 504 22
9 511 533 22
10 595 617 22
11 663 685 22
12 698 720 22
13 741 763 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5713.t1
MATTPTKTDTLVERVPSAEVNSEKFGEKGGEKDQVPSIHEVPLPIYDDAEALSKGTAAPLQTAEEIVTQVIHVDD
DPTLNPWTFRMFFIGLGLSAFGAVLQEIMYFKPQVVYVSVMFLTVLAQTLGTAMSTFIPRRGVIGRFLNPFPWNR
KEHTAAVLMSSAAAVSALSTEALAVQKLYYGGYPNVAAGIFITLSSQLIGYGVAGMMRNVLVHPTSMLYPINLPI
TTVMETLHKPKAETKQRFKVFWIVFAAIFCWEWFPEYIFPLLSAVSIFCLADQHNLIFTNLFGGSQGNEGMGFLS
VCFDWNYIAGFGSPLWMPLQTLANSFIGYIGGIILSMALYYGNIWRAKDFPFMSQLLYDQSSNTTTAVPYNETAI
MNADFTVNSTLVDQAGAPYLTATYVNYLITSNAGLTATIVHMLLWNYAEVSLGWAWMTWSNLKKILDPSFYKFWQ
HTGVRTEEEKEQIRRDPLIDPHYKLMLDYDEVPSSWYFLVFVASWVTGLICLYVMKSTLPWWGFIVATIFLVTFM
VFFGAQYAITGFGYNLQPIFQMIAGYMMPGRPLANMYFTTYTYNGLSQGWLLLRDLKLAQQNKLSPKATFVTQVI
GCVMGALLNYVMMITIVQNQATILETAEGTNIWSGAQIQQFNTLAIAWSIAPKMFSIGARYEWVTAAFLVGFIAP
LPFYIMHRLFPHQRIWSYLNSAIILWYLGELFVGLNASLTSYYILGAFGQFYLRRYRPQWFVKWNYLLSAALDGG
TQVMVFLATFAVFGGSGNSVAFPTWAGNRANNFDYCAYNAQG*
Coding >Pro_DTO377G3_2|g5713.t1
ATGGCGACGACGCCAACCAAAACAGACACCCTGGTTGAGCGCGTACCCTCTGCGGAGGTGAACAGCGAAAAGTTT
GGGGAAAAGGGCGGGGAAAAGGACCAGGTCCCTTCTATTCACGAAGTGCCTCTTCCGATTTATGACGACGCCGAA
GCTCTCTCGAAGGGGACTGCAGCTCCCCTTCAAACTGCGGAGGAGATCGTCACTCAGGTCATTCATGTTGACGAT
GACCCAACACTCAATCCATGGACGTTCCGCATGTTCTTCATTGGTCTCGGATTGTCCGCGTTCGGAGCGGTCCTG
CAAGAGATCATGTACTTCAAGCCCCAGGTTGTTTACGTCTCGGTCATGTTCTTGACTGTCCTTGCTCAAACTCTG
GGTACGGCTATGTCTACCTTTATCCCACGACGGGGTGTCATCGGCCGTTTTCTCAACCCTTTCCCGTGGAACCGG
AAGGAACACACCGCAGCAGTCCTCATGTCCTCGGCGGCAGCTGTCTCGGCCTTGTCTACGGAAGCTTTGGCTGTG
CAAAAGCTCTATTATGGAGGATATCCTAATGTAGCTGCGGGAATCTTCATTACGCTTTCTTCGCAGCTCATTGGG
TATGGCGTTGCAGGCATGATGCGCAATGTTTTGGTACACCCCACCTCAATGCTGTATCCCATCAACCTACCCATC
ACGACTGTCATGGAGACCTTGCACAAGCCCAAAGCGGAGACCAAGCAGAGATTCAAGGTATTCTGGATCGTATTC
GCGGCTATCTTTTGCTGGGAATGGTTCCCCGAGTACATCTTCCCACTTTTGTCCGCGGTTTCCATTTTCTGCTTG
GCCGACCAACACAATCTGATCTTCACAAATCTGTTCGGAGGCTCCCAGGGTAATGAGGGCATGGGATTCCTGTCC
GTCTGCTTTGACTGGAATTATATCGCCGGTTTCGGATCCCCACTTTGGATGCCGCTTCAAACTTTGGCCAACAGT
TTCATTGGTTATATCGGGGGTATCATCCTCTCCATGGCACTTTACTACGGAAATATCTGGAGAGCCAAGGATTTC
CCTTTCATGTCTCAGCTTCTCTACGATCAGAGCTCAAACACGACCACTGCTGTCCCATACAACGAGACTGCAATC
ATGAACGCAGACTTCACCGTGAACAGCACCCTGGTGGATCAGGCTGGAGCTCCTTACCTTACCGCCACGTACGTG
AACTATCTCATCACATCCAACGCTGGGCTCACGGCCACTATTGTTCACATGTTGCTCTGGAACTACGCTGAAGTC
AGCCTTGGATGGGCTTGGATGACATGGAGCAACTTGAAGAAGATTTTGGATCCTTCCTTTTATAAGTTTTGGCAG
CACACTGGTGTCCGAACCGAGGAGGAGAAGGAACAAATTCGTCGGGACCCTTTAATTGACCCTCATTATAAGCTG
ATGCTTGACTACGATGAAGTCCCCAGCAGTTGGTATTTCTTAGTGTTCGTTGCCAGCTGGGTCACTGGTCTGATA
TGCTTATACGTGATGAAGTCCACCCTTCCGTGGTGGGGCTTTATTGTCGCGACCATCTTCCTCGTCACCTTTATG
GTCTTCTTCGGGGCGCAGTATGCCATTACGGGCTTCGGATACAACTTGCAGCCGATTTTCCAAATGATTGCTGGT
TACATGATGCCCGGACGTCCTTTAGCTAATATGTACTTCACCACATACACCTACAACGGTCTCTCGCAAGGGTGG
CTGCTTCTCCGTGATCTGAAACTCGCCCAACAAAACAAACTGTCACCGAAAGCGACGTTCGTCACACAAGTCATC
GGCTGTGTCATGGGCGCCCTTCTCAACTATGTGATGATGATAACCATCGTCCAAAACCAAGCAACCATCCTCGAA
ACCGCCGAAGGAACAAACATCTGGTCCGGCGCCCAAATCCAGCAGTTCAACACTCTCGCCATTGCATGGTCCATC
GCACCCAAGATGTTCTCCATCGGCGCGCGCTACGAATGGGTCACAGCAGCTTTCCTAGTCGGCTTCATCGCCCCA
TTGCCCTTCTACATCATGCACCGTCTCTTCCCGCACCAGCGAATCTGGTCATACCTCAACTCGGCCATTATCCTG
TGGTACCTTGGAGAACTCTTCGTTGGTCTGAACGCTTCTCTCACTAGCTACTACATCCTCGGCGCGTTCGGTCAG
TTCTATCTGCGCCGTTACCGACCGCAGTGGTTTGTGAAGTGGAATTACCTCCTGTCTGCTGCGCTGGACGGTGGC
ACCCAAGTCATGGTGTTCCTGGCTACATTTGCGGTTTTTGGTGGTTCTGGCAACTCGGTTGCTTTCCCGACGTGG
GCAGGTAATCGTGCGAATAATTTCGATTATTGCGCGTATAATGCTCAGGGCTGA
Transcript >Pro_DTO377G3_2|g5713.t1
ATGGCGACGACGCCAACCAAAACAGACACCCTGGTTGAGCGCGTACCCTCTGCGGAGGTGAACAGCGAAAAGTTT
GGGGAAAAGGGCGGGGAAAAGGACCAGGTCCCTTCTATTCACGAAGTGCCTCTTCCGATTTATGACGACGCCGAA
GCTCTCTCGAAGGGGACTGCAGCTCCCCTTCAAACTGCGGAGGAGATCGTCACTCAGGTCATTCATGTTGACGAT
GACCCAACACTCAATCCATGGACGTTCCGCATGTTCTTCATTGGTCTCGGATTGTCCGCGTTCGGAGCGGTCCTG
CAAGAGATCATGTACTTCAAGCCCCAGGTTGTTTACGTCTCGGTCATGTTCTTGACTGTCCTTGCTCAAACTCTG
GGTACGGCTATGTCTACCTTTATCCCACGACGGGGTGTCATCGGCCGTTTTCTCAACCCTTTCCCGTGGAACCGG
AAGGAACACACCGCAGCAGTCCTCATGTCCTCGGCGGCAGCTGTCTCGGCCTTGTCTACGGAAGCTTTGGCTGTG
CAAAAGCTCTATTATGGAGGATATCCTAATGTAGCTGCGGGAATCTTCATTACGCTTTCTTCGCAGCTCATTGGG
TATGGCGTTGCAGGCATGATGCGCAATGTTTTGGTACACCCCACCTCAATGCTGTATCCCATCAACCTACCCATC
ACGACTGTCATGGAGACCTTGCACAAGCCCAAAGCGGAGACCAAGCAGAGATTCAAGGTATTCTGGATCGTATTC
GCGGCTATCTTTTGCTGGGAATGGTTCCCCGAGTACATCTTCCCACTTTTGTCCGCGGTTTCCATTTTCTGCTTG
GCCGACCAACACAATCTGATCTTCACAAATCTGTTCGGAGGCTCCCAGGGTAATGAGGGCATGGGATTCCTGTCC
GTCTGCTTTGACTGGAATTATATCGCCGGTTTCGGATCCCCACTTTGGATGCCGCTTCAAACTTTGGCCAACAGT
TTCATTGGTTATATCGGGGGTATCATCCTCTCCATGGCACTTTACTACGGAAATATCTGGAGAGCCAAGGATTTC
CCTTTCATGTCTCAGCTTCTCTACGATCAGAGCTCAAACACGACCACTGCTGTCCCATACAACGAGACTGCAATC
ATGAACGCAGACTTCACCGTGAACAGCACCCTGGTGGATCAGGCTGGAGCTCCTTACCTTACCGCCACGTACGTG
AACTATCTCATCACATCCAACGCTGGGCTCACGGCCACTATTGTTCACATGTTGCTCTGGAACTACGCTGAAGTC
AGCCTTGGATGGGCTTGGATGACATGGAGCAACTTGAAGAAGATTTTGGATCCTTCCTTTTATAAGTTTTGGCAG
CACACTGGTGTCCGAACCGAGGAGGAGAAGGAACAAATTCGTCGGGACCCTTTAATTGACCCTCATTATAAGCTG
ATGCTTGACTACGATGAAGTCCCCAGCAGTTGGTATTTCTTAGTGTTCGTTGCCAGCTGGGTCACTGGTCTGATA
TGCTTATACGTGATGAAGTCCACCCTTCCGTGGTGGGGCTTTATTGTCGCGACCATCTTCCTCGTCACCTTTATG
GTCTTCTTCGGGGCGCAGTATGCCATTACGGGCTTCGGATACAACTTGCAGCCGATTTTCCAAATGATTGCTGGT
TACATGATGCCCGGACGTCCTTTAGCTAATATGTACTTCACCACATACACCTACAACGGTCTCTCGCAAGGGTGG
CTGCTTCTCCGTGATCTGAAACTCGCCCAACAAAACAAACTGTCACCGAAAGCGACGTTCGTCACACAAGTCATC
GGCTGTGTCATGGGCGCCCTTCTCAACTATGTGATGATGATAACCATCGTCCAAAACCAAGCAACCATCCTCGAA
ACCGCCGAAGGAACAAACATCTGGTCCGGCGCCCAAATCCAGCAGTTCAACACTCTCGCCATTGCATGGTCCATC
GCACCCAAGATGTTCTCCATCGGCGCGCGCTACGAATGGGTCACAGCAGCTTTCCTAGTCGGCTTCATCGCCCCA
TTGCCCTTCTACATCATGCACCGTCTCTTCCCGCACCAGCGAATCTGGTCATACCTCAACTCGGCCATTATCCTG
TGGTACCTTGGAGAACTCTTCGTTGGTCTGAACGCTTCTCTCACTAGCTACTACATCCTCGGCGCGTTCGGTCAG
TTCTATCTGCGCCGTTACCGACCGCAGTGGTTTGTGAAGTGGAATTACCTCCTGTCTGCTGCGCTGGACGGTGGC
ACCCAAGTCATGGTGTTCCTGGCTACATTTGCGGTTTTTGGTGGTTCTGGCAACTCGGTTGCTTTCCCGACGTGG
GCAGGTAATCGTGCGAATAATTTCGATTATTGCGCGTATAATGCTCAGGGCTGA
Gene >Pro_DTO377G3_2|g5713.t1
ATGGCGACGACGCCAACCAAAACAGACACCCTGGTTGAGCGCGTACCCTCTGCGGAGGTGAACAGCGAAAAGTTT
GGGGAAAAGGGCGGGGAAAAGGACCAGGTCCCTTCTATTCACGAAGTGCCTCTTCCGATTTATGACGACGCCGAA
GCTCTCTCGAAGGGGACTGCAGCTCCCCTTCAAACTGCGGAGGAGATCGTCACTCAGGTCATTCATGTTGACGAT
GACCCAACACTCAATCCATGGACGTTCCGCATGTTCTTCATTGGTGAGCCTTTTCATTGTGTCCTCTGTGGTAAT
CTAGCATGTCGCTGACTCGAATCAGGTCTCGGATTGTCCGCGTTCGGAGCGGTCCTGCAAGAGATCATGTACTTC
AAGCCCCAGGTTGTTTACGTCTCGGTCATGTTCTTGACTGTCCTTGCTCAAACTCTGGGTACGGCTATGTCTACC
TTTATCCCACGACGGGGTGTCATCGGCCGTTTTCTCAACCCTTTCCCGTGGAACCGGAAGGAACACACCGCAGCA
GTCCTCATGTCCTCGGCGGCAGCTGTCTCGGCCTTGTCTACGGAAGCTTTGGCTGTGCAAAAGCTCTATTATGGA
GGATATCCTAATGTAGCTGCGGGAATCTTCATTACGCTTTCTTCGCAGCTCATTGGGTATGGCGTTGCAGGCATG
ATGCGCAATGTTTTGGTACACCCCACCTCAATGCTGTATCCCATCAACCTACCCATCACGACTGTCATGGAGACC
TTGCACAAGCCCAAAGCGGAGACCAAGCAGAGATTCAAGGTATTCTGGATCGTATTCGCGGCTATCTTTTGCTGG
GAATGGTTCCCCGAGGTACGTTTGCTCAACCACATCGATCTACCTTACAGGCTCTGACAATATCTAGTACATCTT
CCCACTTTTGTCCGCGGTTTCCATTTTCTGCTTGGCCGACCAACACAATCTGATCTTCACAAATCTGTTCGGAGG
CTCCCAGGGTAATGAGGGCATGGGATTCCTGTCCGTCTGCTTTGACTGGAATTATATCGCCGGTTTCGGATCCCC
ACTTTGGATGCCGCTTCAAACTTTGGCCAACAGTTTCATTGGTTATATCGGGGGTATCATCCTCTCCATGGCACT
TTACTACGGAAATATCTGGAGAGCCAAGGATTTCCCTTTCATGTCTCAGCTTCTCTACGATCAGAGCTCAAACAC
GACCACTGCTGTCCCATACAACGAGACTGCAATCATGAACGCAGACTTCACCGTGAACAGCACCCTGGTGGATCA
GGCTGGAGCTCCTTACCTTACCGCCACGTACGTGAACTATCTCATCACATCCAACGCTGGGCTCACGGCCACTAT
TGTTCACATGTTGCTCTGGAACTACGCTGAAGTCAGCCTTGGATGGGCTTGGATGACATGGAGCAACTTGAAGAA
GATTTTGGATCCTTCCTTTTATAAGTTTTGGCAGCACACTGGTGTCCGAACCGAGGAGGAGAAGGAACAAATTCG
TCGGGACCCTTTAATTGACCCTCATTATAAGCTGATGCTTGACTACGATGAAGTCCCCAGCAGTTGGTATTTCTT
AGTGTTCGTTGCCAGCTGGGTCACTGGTCTGATATGCTTATACGTGATGAAGTCCACCCTTCCGTGGTGGGGCTT
TATTGTCGCGACCATCTTCCTCGTCACCTTTATGGTCTTCTTCGGGGCGCAGTATGCCATTACGGGCTTCGGATA
CAACTTGCAGCCGATTTTCCAAATGATTGCTGGTTACATGATGCCCGGACGTCCTTTAGGTATACACTCCACTAC
TTTGACTGCTTTTGAGATCATTCCACTGACAACTCTCCAGCTAATATGTACTTCACCACATACACCTACAACGGT
CTCTCGCAAGGGTGGCTGCTTCTCCGTGATCTGAAACTCGCCCAACAAAACAAACTGTCACCGAAAGCGACGTTC
GTCACACAAGTCATCGGCTGTGTCATGGGCGCCCTTCTCAACTATGTGATGATGATAACGTAAGTCCCATCCCTT
ACCTACCCCGGTATAAGATTCCCATCCAGTCTAACTCCTCTCCAGCATCGTCCAAAACCAAGCAACCATCCTCGA
AACCGCCGAAGGAACAAACATCTGGTCCGGCGCCCAAATCCAGCAGTTCAACACTCTCGCCATTGCATGGTCCAT
CGCACCCAAGATGTTCTCCATCGGCGCGCGCTACGAATGGGTCACAGCAGCTTTCCTAGTCGGCTTCATCGCCCC
ATTGCCCTTCTACATCATGCACCGTCTCTTCCCGCACCAGCGAATCTGGTCATACCTCAACTCGGCCATTATCCT
GTGGTACCTTGGAGAACTCTTCGTTGGTCTGAACGCTTCTCTCACTAGCTACTACATCCTCGGCGCGTTCGGTCA
GTTCTATCTGCGCCGTTACCGACCGCAGTGGTTTGTGAAGTGGAATTACCTCCTGTCTGCTGCGCTGGACGGTGG
CACCCAAGTCATGGTGTTCCTGGCTACATTTGCGGTTTTTGGTGGTTCTGGCAACTCGGTTGCTTTCCCGACGTG
GGCAGGTAATCGTGCGAATAATTTCGATTATTGCGCGTATAATGCTCAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail