Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5680.t1
Gene name
Locationscaffold_14:122693..125057
Strand-
Gene length (bp)2364
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 8.1E-39 7 143
PF01363 FYVE FYVE zinc finger 4.1E-16 168 225
PF02809 UIM Ubiquitin interaction motif 5.7E+01 12 25
PF02809 UIM Ubiquitin interaction motif 1.2E-02 263 277
PF02809 UIM Ubiquitin interaction motif 5.6E-02 307 322

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0046872 metal ion binding Yes
GO:0051179 localization No
GO:0043169 cation binding No
GO:0042886 amide transport No
GO:0071702 organic substance transport No
GO:0051641 cellular localization No
GO:0051234 establishment of localization No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0033036 macromolecule localization No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0015031 protein transport No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5680.t1
MAGWFSSTSPLDEQIERATASSLEDIALNLEISDMIRSKSVQPKDGMRSLKRRLENKNPNIQLATLKLTDTCVKN
GGTHFLAEIASREFMDNLVSLLKSEGAPLNAEVQGKILELIQNWAMAAQGRMDLMYLGETYRKLESEGYRFPPKT
EMSGSMLESSAPPEWIDSEVCMRCRTAFSFMNRKHHCRNCGNVFDAQCSSKTIPLPHLGILQPVRVDDGCYAKLT
SKSFAPPGISDRSAFKNNSISKSNTMEPRAGKPDTGFDEDLRRALQMSLDEAEGRGPSGFVPQTGNAPEPAKAVP
KPENVDEEDPDLKAAIEASLRDMEQHKQNHAAALKNVPTSNSTLRDSSSTPTQLPKNPYELTPVETENIHLFSTL
VDRLQHQPPGTILREPQIQELYESIGALRPKLARSYGETMSKHDTLLDLHAKLSTVVRYYDRMLEERLTRAYSQH
NLGHGAVPGGAQYPNLQPAFSNHAPDVQSGAENFYYGTQMDSSRPPTTMYAPQQVNGDGFQVPSTYPSQAQHGAP
TNESYGQNWGGNTYPALGSPPPSNGIPNNYANAPTPSAPAQYYAAPHDQDTARSPGAESPYQPSPIMRRDSSQYQ
AGATPSGPTPAPEQHASAGYVQSPGYSVPPTAPALHQQATGPSQSYYYPSQPQPQQPPNAVSSAYPPINAGQPGS
YGQETSQPPYQQPARPVEENLIEL*
Coding >Pro_DTO377G3_2|g5680.t1
ATGGCAGGCTGGTTCTCTTCAACCTCGCCGCTCGATGAGCAAATCGAGCGGGCGACAGCTTCCTCCTTGGAAGAC
ATTGCCCTCAACCTGGAGATATCAGATATGATTCGATCAAAGAGCGTTCAGCCCAAGGATGGAATGAGGTCTTTG
AAACGACGACTCGAGAATAAGAATCCCAACATCCAGCTGGCGACACTGAAGTTAACGGATACTTGTGTCAAAAAC
GGAGGAACACATTTCCTGGCCGAGATCGCGTCTCGAGAATTCATGGATAACCTTGTCTCATTGCTTAAATCCGAA
GGCGCTCCTCTTAATGCCGAGGTGCAGGGCAAGATATTGGAACTTATCCAGAATTGGGCTATGGCTGCACAAGGC
CGTATGGATTTGATGTATTTGGGAGAGACATATCGCAAATTGGAGAGTGAAGGATACCGGTTTCCACCAAAGACC
GAAATGAGCGGCAGTATGCTGGAAAGCAGCGCACCTCCAGAGTGGATCGACTCTGAAGTCTGTATGCGATGTCGG
ACTGCCTTCAGTTTTATGAATCGCAAACACCACTGCCGTAACTGCGGCAACGTGTTCGACGCTCAGTGTTCAAGC
AAGACCATTCCTTTACCGCATCTTGGAATTCTGCAGCCCGTCAGAGTAGACGATGGATGCTATGCCAAATTGACC
TCCAAGTCATTTGCGCCACCGGGAATTTCGGATCGGTCCGCGTTCAAAAACAACTCCATCAGCAAATCTAACACG
ATGGAACCTCGTGCTGGTAAACCGGACACAGGGTTCGATGAGGATTTGCGTCGAGCGTTGCAAATGAGTCTCGAT
GAAGCCGAGGGCAGAGGTCCTTCCGGGTTTGTACCGCAGACAGGCAACGCTCCAGAACCGGCCAAGGCTGTTCCA
AAGCCGGAGAATGTGGACGAGGAAGATCCGGATCTCAAGGCTGCGATTGAAGCATCCCTGCGTGATATGGAACAA
CACAAGCAAAACCATGCGGCCGCATTGAAGAACGTGCCCACTTCAAATTCCACCTTGCGCGATTCCTCGAGCACG
CCCACTCAATTGCCTAAAAATCCGTACGAACTAACCCCTGTTGAAACCGAGAATATTCATCTCTTCTCTACACTG
GTTGATCGGCTCCAGCATCAGCCGCCGGGCACAATTCTTAGAGAGCCGCAGATCCAGGAGCTATACGAGAGTATC
GGTGCGCTTCGACCAAAGCTGGCACGAAGCTATGGAGAGACCATGAGTAAACATGATACATTATTGGACCTCCAT
GCCAAGCTCTCTACGGTTGTACGCTACTACGATCGGATGCTAGAAGAGCGTCTGACCAGAGCCTATTCCCAACAC
AATCTTGGTCATGGAGCTGTTCCTGGGGGCGCGCAGTATCCAAATCTTCAGCCAGCCTTCTCTAATCACGCTCCC
GACGTCCAGAGTGGAGCCGAGAATTTCTATTATGGAACTCAAATGGACAGCTCTCGCCCACCTACTACTATGTAT
GCTCCGCAGCAGGTGAACGGCGATGGGTTCCAAGTTCCATCCACCTACCCATCACAAGCTCAACATGGTGCCCCG
ACAAATGAGTCTTATGGTCAGAATTGGGGTGGAAATACCTACCCGGCCCTTGGATCACCTCCACCTAGCAATGGC
ATTCCAAATAACTATGCCAATGCCCCAACGCCCAGTGCCCCGGCTCAATATTACGCAGCACCACACGACCAAGAC
ACAGCCAGGTCACCCGGCGCAGAATCCCCATACCAGCCGTCGCCCATTATGCGCCGGGACTCCTCTCAGTATCAG
GCCGGTGCAACTCCCAGCGGTCCAACCCCCGCTCCCGAACAACACGCATCTGCCGGGTATGTGCAATCGCCGGGC
TATTCTGTGCCACCCACTGCGCCAGCACTTCATCAGCAGGCAACGGGCCCTTCTCAGTCTTACTATTACCCGTCA
CAACCCCAGCCTCAACAACCTCCTAATGCTGTGTCATCTGCATACCCTCCGATTAACGCTGGACAACCGGGGTCG
TATGGACAGGAAACTTCGCAACCGCCTTATCAGCAACCAGCACGGCCCGTGGAGGAGAACCTGATTGAGCTATAG
Transcript >Pro_DTO377G3_2|g5680.t1
ATGGCAGGCTGGTTCTCTTCAACCTCGCCGCTCGATGAGCAAATCGAGCGGGCGACAGCTTCCTCCTTGGAAGAC
ATTGCCCTCAACCTGGAGATATCAGATATGATTCGATCAAAGAGCGTTCAGCCCAAGGATGGAATGAGGTCTTTG
AAACGACGACTCGAGAATAAGAATCCCAACATCCAGCTGGCGACACTGAAGTTAACGGATACTTGTGTCAAAAAC
GGAGGAACACATTTCCTGGCCGAGATCGCGTCTCGAGAATTCATGGATAACCTTGTCTCATTGCTTAAATCCGAA
GGCGCTCCTCTTAATGCCGAGGTGCAGGGCAAGATATTGGAACTTATCCAGAATTGGGCTATGGCTGCACAAGGC
CGTATGGATTTGATGTATTTGGGAGAGACATATCGCAAATTGGAGAGTGAAGGATACCGGTTTCCACCAAAGACC
GAAATGAGCGGCAGTATGCTGGAAAGCAGCGCACCTCCAGAGTGGATCGACTCTGAAGTCTGTATGCGATGTCGG
ACTGCCTTCAGTTTTATGAATCGCAAACACCACTGCCGTAACTGCGGCAACGTGTTCGACGCTCAGTGTTCAAGC
AAGACCATTCCTTTACCGCATCTTGGAATTCTGCAGCCCGTCAGAGTAGACGATGGATGCTATGCCAAATTGACC
TCCAAGTCATTTGCGCCACCGGGAATTTCGGATCGGTCCGCGTTCAAAAACAACTCCATCAGCAAATCTAACACG
ATGGAACCTCGTGCTGGTAAACCGGACACAGGGTTCGATGAGGATTTGCGTCGAGCGTTGCAAATGAGTCTCGAT
GAAGCCGAGGGCAGAGGTCCTTCCGGGTTTGTACCGCAGACAGGCAACGCTCCAGAACCGGCCAAGGCTGTTCCA
AAGCCGGAGAATGTGGACGAGGAAGATCCGGATCTCAAGGCTGCGATTGAAGCATCCCTGCGTGATATGGAACAA
CACAAGCAAAACCATGCGGCCGCATTGAAGAACGTGCCCACTTCAAATTCCACCTTGCGCGATTCCTCGAGCACG
CCCACTCAATTGCCTAAAAATCCGTACGAACTAACCCCTGTTGAAACCGAGAATATTCATCTCTTCTCTACACTG
GTTGATCGGCTCCAGCATCAGCCGCCGGGCACAATTCTTAGAGAGCCGCAGATCCAGGAGCTATACGAGAGTATC
GGTGCGCTTCGACCAAAGCTGGCACGAAGCTATGGAGAGACCATGAGTAAACATGATACATTATTGGACCTCCAT
GCCAAGCTCTCTACGGTTGTACGCTACTACGATCGGATGCTAGAAGAGCGTCTGACCAGAGCCTATTCCCAACAC
AATCTTGGTCATGGAGCTGTTCCTGGGGGCGCGCAGTATCCAAATCTTCAGCCAGCCTTCTCTAATCACGCTCCC
GACGTCCAGAGTGGAGCCGAGAATTTCTATTATGGAACTCAAATGGACAGCTCTCGCCCACCTACTACTATGTAT
GCTCCGCAGCAGGTGAACGGCGATGGGTTCCAAGTTCCATCCACCTACCCATCACAAGCTCAACATGGTGCCCCG
ACAAATGAGTCTTATGGTCAGAATTGGGGTGGAAATACCTACCCGGCCCTTGGATCACCTCCACCTAGCAATGGC
ATTCCAAATAACTATGCCAATGCCCCAACGCCCAGTGCCCCGGCTCAATATTACGCAGCACCACACGACCAAGAC
ACAGCCAGGTCACCCGGCGCAGAATCCCCATACCAGCCGTCGCCCATTATGCGCCGGGACTCCTCTCAGTATCAG
GCCGGTGCAACTCCCAGCGGTCCAACCCCCGCTCCCGAACAACACGCATCTGCCGGGTATGTGCAATCGCCGGGC
TATTCTGTGCCACCCACTGCGCCAGCACTTCATCAGCAGGCAACGGGCCCTTCTCAGTCTTACTATTACCCGTCA
CAACCCCAGCCTCAACAACCTCCTAATGCTGTGTCATCTGCATACCCTCCGATTAACGCTGGACAACCGGGGTCG
TATGGACAGGAAACTTCGCAACCGCCTTATCAGCAACCAGCACGGCCCGTGGAGGAGAACCTGATTGAGCTATAG
Gene >Pro_DTO377G3_2|g5680.t1
ATGGCAGGCTGGTTCTCTTCAACCTCGCCGCTCGATGAGCAAATCGAGCGGGCGACAGCTTCCTCCTTGTGAGTT
TTGATTGCCGCGTTGTTATCATACCTATATGAACCGGGGCTACCTACCAGGATGCTCTGAAATGAATGATCGCGT
GGCTAACTCACTCTCAGGGAAGACATTGCCCTCAACCTGGAGATATCAGATATGATTCGATCAAAGAGCGTTCAG
CCCAAGGATGGAATGAGGTCTTTGAAACGACGACTCGAGAATAAGAATCCCAACATCCAGCTGGCGACACTGAAG
GTGAAACATTTATTCCCGTGAGACTAGGCTTGGAACAAGCGCTGATAAGCCCGCCCCTCTAGTTAACGGATACTT
GTGTCAAAAACGGAGGAACACATTTCCTGGCCGAGATCGCGTCTCGAGAATTCATGGATAACCTTGTCTCATTGC
TTAAATCCGAAGGCGCTCCTCTTAATGCCGAGGTGCAGGGCAAGATATTGGAACTTATCCAGAATTGGGCTATGG
CTGCACAAGGCCGTATGGATTTGATGTATTTGGGAGAGACATATCGCAAATTGGAGAGTGAAGGATACCGGTTTC
CACCAAAGACCGAAATGAGCGGCAGTATGCTGGAAAGCAGCGCAGTGAGTGTGCCTCAAACCCTTCCGTTGCAGA
AGCTAATTTGTGAATCTGTCTCAGCCTCCAGAGTGGATCGACTCTGAAGTCTGTATGCGATGTCGGACTGCCTTC
AGTTTTATGAATCGCAAACACCACTGCCGTAACTGCGGCAACGTGTTCGACGCTCAGTGTTCAAGCAAGACCATT
CCTTTACCGCATCTTGGAATTCTGCAGCCCGTCAGAGTAGACGATGGATGCTATGCCAAATTGACCTCCAAGTCA
TTTGCGCCACCGGGAATTTCGGATCGGTCCGCGTTCAAAAACAACTCCATCAGCAAATCTAACACGATGGAACCT
CGTGCTGGTAAACCGGACACAGGGTTCGATGAGGATTTGCGTCGAGCGTTGCAAATGAGTCTCGATGAAGCCGAG
GGCAGAGGTCCTTCCGGGTTTGTACCGCAGACAGGCAACGCTCCAGAACCGGCCAAGGCTGTTCCAAAGCCGGAG
AATGTGGACGAGGAAGATCCGGATCTCAAGGCTGCGATTGAAGCATCCCTGCGTGATATGGAACAACACAAGCAA
AACCATGCGGCCGCATTGAAGAACGTGCCCACTTCAAATTCCACCTTGCGCGATTCCTCGAGCACGCCCACTCAA
TTGCCTAAAAATCCGTACGAACTAACCCCTGTTGAAACCGAGAATATTCATCTCTTCTCTACACTGGTTGATCGG
CTCCAGCATCAGCCGCCGGGCACAATTCTTAGAGAGCCGCAGATCCAGGAGCTATACGAGAGTATCGGTGCGCTT
CGACCAAAGCTGGCACGAAGCTATGGAGAGACCATGAGTAAACATGGTGAGTTCAGCTGTCTTTATTTATAGAAC
TGCAAGCTAATCCTCACAGATACATTATTGGACCTCCATGCCAAGCTCTCTACGGTTGTACGCTACTACGATCGG
ATGCTAGAAGAGCGTCTGACCAGAGCCTATTCCCAACACAATCTTGGTCATGGAGCTGTTCCTGGGGGCGCGCAG
TATCCAAATCTTCAGCCAGCCTTCTCTAATCACGCTCCCGACGTCCAGAGTGGAGCCGAGAATTTCTATTATGGA
ACTCAAATGGACAGCTCTCGCCCACCTACTACTATGTATGCTCCGCAGCAGGTGAACGGCGATGGGTTCCAAGTT
CCATCCACCTACCCATCACAAGCTCAACATGGTGCCCCGACAAATGAGTCTTATGGTCAGAATTGGGGTGGAAAT
ACCTACCCGGCCCTTGGATCACCTCCACCTAGCAATGGCATTCCAAATAACTATGCCAATGCCCCAACGCCCAGT
GCCCCGGCTCAATATTACGCAGCACCACACGACCAAGACACAGCCAGGTCACCCGGCGCAGAATCCCCATACCAG
CCGTCGCCCATTATGCGCCGGGACTCCTCTCAGTATCAGGCCGGTGCAACTCCCAGCGGTCCAACCCCCGCTCCC
GAACAACACGCATCTGCCGGGTATGTGCAATCGCCGGGCTATTCTGTGCCACCCACTGCGCCAGCACTTCATCAG
CAGGCAACGGGCCCTTCTCAGTCTTACTATTACCCGTCACAACCCCAGCCTCAACAACCTCCTAATGCTGTGTCA
TCTGCATACCCTCCGATTAACGCTGGACAACCGGGGTCGTATGGACAGGAAACTTCGCAACCGCCTTATCAGCAA
CCAGCACGGCCCGTGGAGGAGAACCTGATTGAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail