Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5677.t1
Gene name
Locationscaffold_14:112694..117602
Strand+
Gene length (bp)4908
Transcript length (bp)4908
Coding sequence length (bp)4908
Protein length (aa) 1636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.5E-06 408 464
PF00651 BTB BTB/POZ domain 5.6E-11 914 1029
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 1.2E-07 391 420
PF13637 Ank_4 Ankyrin repeats (many copies) 3.9E-05 121 156

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.38 11.16 25.60
5d_25C Five days - 25 degrees Celsius 21.01 12.75 29.26
7d_25C Seven days - 25 degrees Celsius 23.22 14.16 32.28
10d_25C Ten days - 25 degrees Celsius 25.79 15.72 35.86
7d_15C Seven days - 15 degrees Celsius 19.08 11.46 26.70
7d_30C Seven days - 30 degrees Celsius 17.64 10.67 24.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.626045 no
3d_25C 7d_25C 0.333095 no
3d_25C 7d_15C 0.912734 no
3d_25C 7d_30C 0.901940 no
3d_25C 10d_25C 0.129241 no
5d_25C 7d_25C 0.730707 no
5d_25C 7d_15C 0.748449 no
5d_25C 7d_30C 0.498726 no
5d_25C 10d_25C 0.408575 no
7d_25C 7d_15C 0.439972 no
7d_25C 7d_30C 0.233813 no
7d_25C 10d_25C 0.715200 no
7d_15C 7d_30C 0.798027 no
7d_15C 10d_25C 0.184336 no
7d_30C 10d_25C 0.080143 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5677.t1
MSNKLWECFIQDDVERFQRSLANATFAGPRAAGGSGGTSRAATNLSSKAGSPGSMIASSPNIPRNKKNIASSPGA
FVPDRAALPRGSATLSRADVNARDHYGRTLLHHVASSSRPTASKFARALLEVPFIDIYAQDWESGWTALHRALYA
GNATIALALMARDLQDMTDFSKGGNTSHPSGGLIKIKDREGCSPFDVFGATIRARDIKHISENWPSSYNDDDALG
SDVASNAASNFGDDGEDGAYTLRSVLKGAVDLAADEVFTLGSNKNLNLGLGDQDDRQFPERISLKRPEHLLHRFY
REYHEKLEHLGLEDTVPKTKTTELPTLITNKPMKFQDIIMSKLHTAIITDDPEANLFMCGFGPGGRLGTGDESTR
FTFACIETGGLEGKKVLSAALGQDHSLAITEQGEIFSWGSNKFGQLGYGLPRTSNKNDIPIQTTPRQIFNPFKKE
TIIGAAASSIHSVVFSTSGLYTFGKNEGQLGLVDSDARSLEIQTTPRRVGASLFSCPIKMVSAIDRATSVLLQNH
EVWVFSSYGYSKLSFPLEVSSRFIRDSFMATRYDKTANRVVKIVCGGNTICALSSSGDVFTVQANQSDNSSALTS
TTNPAKIRNSLAAPVKAWSVKKSYMAASDVDVGQDGSIIICTTSGSAWRKERRTKNKEGASKEYKFARIPGLSRA
VAVRSNAFGAYAVAQRDCEVTREQINVEQSSLWDDMLPLSPFSTPGLEELDSILEDDAKNIPLVLSSGKSIQRAI
LSSSDIESQFLSVRSEGTVWVTSSLSDSCIPVHEFLIAGRIPILGKALAEFRQSYYSSVPDVFGIEYGKDGHPQI
CLQGVDFLTVMNVVFFLYTDGILDVWRLARSSPANSARFRQVRTEVMRVSMQLGLPALERAARLMVEPQRSLKID
MAHAINHSFLFDSADVTLQLKGDTIKVHSQVVCQRCPFFDTLFHGHAGGRWLDSRKADPNQSVHVDLKHIDRSTF
EFVLRYLYADTEDRLFDEVRIGDVDDFIDLLLDVMFVANELMIDRLSQVCQKMLGRFVTTRNVCYLLNSIAPCCV
TEFKDAALEYICLNLEAMLANRYLEDLDPTLLWELDLICHENQLACWPISRGRNSEEYVFEKYPELVSSVEADKQ
RRIDAMTLQSRLGRFEPYDDARTRSMHNEKGTSSPSARKAKNSVSRESPNVGNSPMLKSRPSVGDLMFQMDDEAL
ISPSASKGKGVMRELRFTEGIPENQSYPDSPALGASVPEAESFGEYGFLKDQMSSPQDPLLQSPSESRAMTKNQK
EALASSSNPSSAPWTSPMISSSKKDIKDIMGEALQSRVSNLTLGMADRRESSGNFVPKISQKERKKLQQQQIQDQ
LAAQQKAKEAPQNPWQKPAASSPASLPKLDPLPGQSAPASQAVKSSPQRSMTMRQTVAGTPPSKSKTVATPVQTQ
RRSVSGNPQPYSHSKPSVSGPSTVPPNNQPSSPQPVIQSIRHIPRPDLTGSRSSPSGSYSLSAILLQQQTEKEAI
REAATAKHKMQEIQAEQEFQQWWDQESKRVQGLVDPEPNEPRPGKGGRGGKTSSAASGPRKRRANKNTGDGPAPQ
DHRRVSAPGSGHTNPKTNQSGQAPAQSQRAPNKNRAGDVSGNANGRRGGGNQRGRGKNDA*
Coding >Pro_DTO377G3_2|g5677.t1
ATGAGTAATAAGCTTTGGGAGTGTTTCATTCAAGATGATGTCGAGCGGTTCCAGCGGTCTCTGGCGAACGCGACG
TTCGCGGGCCCGCGAGCTGCCGGAGGCTCAGGAGGGACCTCCAGAGCTGCGACAAACCTGTCATCGAAAGCTGGA
AGCCCTGGGTCCATGATTGCTTCGTCTCCAAATATACCGAGAAATAAAAAGAATATCGCATCATCCCCTGGGGCC
TTTGTGCCTGACCGGGCGGCCTTACCGCGTGGGAGCGCGACTTTGTCGCGTGCCGATGTTAACGCCCGTGATCAT
TACGGCCGTACACTGCTGCACCATGTCGCTTCGTCCTCGAGACCTACCGCGTCCAAATTTGCACGTGCTTTGTTA
GAAGTTCCGTTTATCGATATATATGCGCAGGACTGGGAGAGTGGGTGGACGGCTCTGCATCGGGCTCTTTATGCC
GGGAACGCCACAATTGCTCTGGCGCTCATGGCGCGCGATCTGCAGGACATGACAGATTTCAGCAAAGGTGGAAAT
ACGAGCCATCCAAGTGGTGGCCTTATCAAGATCAAGGATCGTGAGGGTTGCAGTCCTTTTGATGTCTTCGGGGCG
ACTATTAGAGCCCGCGACATTAAGCATATCTCTGAAAACTGGCCAAGTTCATATAATGATGATGATGCCCTCGGC
AGCGATGTTGCTTCCAATGCTGCGTCGAACTTCGGAGATGATGGGGAAGATGGGGCATACACTCTTAGGAGTGTC
CTGAAAGGGGCCGTGGATCTTGCCGCCGATGAAGTCTTCACATTAGGAAGCAACAAAAACCTGAACCTTGGTTTA
GGGGATCAGGATGACAGACAATTTCCTGAGCGCATCTCATTGAAGCGCCCTGAGCATCTTTTGCATCGATTTTAT
CGTGAATATCACGAGAAATTGGAACACCTAGGGCTCGAAGATACCGTGCCTAAGACCAAAACGACCGAGCTGCCC
ACTTTGATCACAAACAAGCCAATGAAGTTCCAAGACATTATTATGTCCAAACTGCATACTGCCATAATCACAGAT
GACCCCGAGGCTAATCTGTTCATGTGTGGATTCGGTCCTGGAGGGCGCCTAGGAACGGGAGATGAGTCGACGCGT
TTCACCTTTGCTTGTATTGAGACAGGTGGACTAGAGGGGAAGAAAGTCTTATCGGCTGCTCTGGGTCAAGACCAT
AGCCTGGCAATCACCGAGCAGGGTGAGATCTTCAGCTGGGGAAGCAACAAGTTCGGACAACTTGGCTATGGCCTT
CCTAGGACTAGCAACAAAAACGACATTCCCATCCAGACGACTCCTCGCCAGATTTTCAATCCGTTCAAGAAAGAG
ACGATCATAGGTGCAGCAGCGTCATCTATTCACTCGGTGGTCTTCAGTACCTCTGGTCTCTATACGTTTGGCAAG
AACGAAGGTCAACTTGGCTTGGTCGATTCCGATGCGCGTTCGCTTGAGATACAAACGACACCACGGCGCGTTGGA
GCATCTCTTTTCAGTTGTCCAATCAAGATGGTGTCCGCCATTGACCGTGCTACGTCTGTGCTTCTGCAGAACCAC
GAAGTTTGGGTTTTCTCATCATATGGCTATTCAAAGCTTTCATTCCCACTAGAAGTGAGCTCCAGATTTATCAGG
GATAGCTTCATGGCAACCAGATACGACAAGACTGCAAACCGTGTTGTCAAGATTGTGTGTGGAGGCAACACCATA
TGTGCATTATCCAGCTCTGGTGATGTATTCACTGTTCAAGCCAACCAGTCCGATAACTCTTCGGCTTTAACGTCC
ACAACCAATCCTGCAAAGATTCGAAATTCATTAGCCGCCCCTGTTAAAGCATGGTCCGTTAAGAAATCATACATG
GCAGCGAGTGATGTTGATGTTGGACAAGACGGATCGATTATCATCTGTACAACATCTGGATCTGCGTGGAGAAAA
GAACGGCGGACAAAGAACAAGGAGGGAGCGTCGAAAGAATATAAATTTGCCCGCATACCTGGTCTCTCACGGGCA
GTGGCAGTGCGCAGCAATGCGTTTGGGGCCTACGCCGTGGCTCAACGTGACTGCGAAGTGACCAGGGAACAAATT
AATGTCGAGCAAAGCAGCCTTTGGGATGATATGTTGCCGTTGTCCCCGTTTTCAACCCCAGGTCTGGAAGAGTTG
GACTCGATCCTCGAAGATGACGCTAAGAATATCCCTCTTGTACTTTCATCCGGAAAAAGCATCCAAAGAGCCATC
CTTTCATCATCGGATATTGAAAGCCAATTTCTTTCTGTACGGAGCGAGGGGACTGTTTGGGTGACCAGCTCCCTA
TCCGACTCTTGTATTCCTGTTCATGAATTTCTCATAGCTGGCCGCATTCCTATTCTTGGAAAGGCATTGGCCGAG
TTCCGCCAGTCATATTATTCATCCGTCCCCGACGTTTTTGGTATTGAATACGGGAAGGACGGACATCCGCAGATC
TGCCTTCAAGGTGTTGATTTTTTGACCGTTATGAACGTGGTCTTTTTCCTTTACACAGACGGTATTCTCGATGTC
TGGCGCCTGGCAAGGAGCTCGCCCGCAAACTCGGCCCGTTTCCGGCAGGTTCGCACTGAAGTTATGCGGGTTTCT
ATGCAACTAGGCCTGCCAGCGCTGGAGCGGGCAGCACGACTAATGGTCGAGCCGCAAAGGAGCCTGAAAATCGAC
ATGGCCCATGCCATCAATCACTCGTTCTTATTTGACAGCGCAGACGTGACTCTTCAGCTCAAAGGCGATACAATC
AAAGTGCACAGTCAAGTCGTGTGCCAGAGATGTCCGTTCTTTGACACACTCTTCCATGGTCATGCGGGTGGAAGG
TGGCTAGACTCGCGCAAGGCGGACCCAAACCAGAGCGTGCATGTCGACCTAAAGCACATTGATCGCTCGACATTT
GAATTCGTCCTGCGTTACCTATATGCCGATACGGAAGACCGACTGTTTGATGAAGTACGGATTGGAGATGTTGAT
GATTTCATTGACTTGCTTCTGGATGTCATGTTCGTGGCAAATGAGCTGATGATCGACCGACTATCTCAAGTATGT
CAGAAGATGCTCGGTCGTTTCGTCACAACGCGAAACGTGTGCTATTTGCTCAATTCAATTGCCCCTTGCTGTGTC
ACAGAGTTCAAGGATGCTGCCCTGGAATATATCTGTCTAAATCTCGAGGCCATGCTCGCTAACAGATATCTCGAA
GATCTGGATCCTACTCTGCTTTGGGAGTTGGATCTGATCTGTCACGAAAATCAGTTGGCGTGCTGGCCCATATCC
CGTGGGCGCAATTCTGAGGAGTATGTCTTCGAGAAATACCCCGAACTTGTCAGCTCCGTGGAAGCAGATAAGCAA
CGAAGGATCGATGCCATGACTTTGCAGTCCCGCCTTGGTCGTTTCGAGCCGTATGACGATGCGCGAACCCGGTCA
ATGCATAACGAGAAGGGTACCTCATCTCCGTCTGCACGCAAGGCGAAGAACAGTGTATCCCGGGAGTCACCAAAT
GTTGGTAATAGCCCAATGCTGAAGTCGAGACCGTCGGTTGGTGATCTCATGTTTCAAATGGACGACGAGGCCCTC
ATATCACCAAGTGCTTCGAAAGGCAAGGGTGTCATGCGTGAACTCAGGTTCACAGAAGGCATACCTGAAAATCAA
TCATACCCTGACTCCCCAGCTTTGGGGGCAAGCGTCCCAGAGGCCGAGTCCTTCGGTGAGTATGGTTTCTTGAAG
GATCAGATGTCTTCCCCACAAGATCCGCTACTACAGTCCCCATCTGAGTCCAGGGCGATGACAAAAAACCAAAAA
GAAGCCCTAGCATCGTCATCTAATCCCTCTTCTGCGCCATGGACCTCGCCAATGATTTCTAGTTCCAAGAAGGAT
ATCAAAGACATCATGGGAGAAGCATTACAGTCTCGGGTATCCAATCTCACGCTAGGCATGGCAGATCGACGCGAA
AGCAGCGGTAACTTCGTGCCTAAGATCTCTCAGAAGGAGCGAAAGAAGCTTCAGCAACAACAGATACAAGATCAG
CTGGCTGCCCAGCAGAAGGCGAAGGAGGCACCACAGAACCCCTGGCAAAAGCCAGCAGCTTCTTCTCCAGCGTCG
CTCCCTAAACTCGACCCTCTCCCAGGTCAAAGCGCCCCAGCATCTCAGGCTGTTAAATCATCACCTCAAAGGTCC
ATGACTATGCGGCAGACTGTGGCTGGCACGCCGCCGTCAAAGTCAAAGACAGTGGCTACACCCGTGCAAACACAA
CGCCGTAGTGTGTCAGGGAACCCACAGCCCTATTCTCATTCGAAACCTTCCGTATCGGGACCTTCTACAGTACCT
CCCAACAATCAACCATCATCACCACAGCCAGTCATCCAGTCAATTCGTCACATCCCACGCCCTGACCTAACAGGA
TCACGCTCTTCACCCTCTGGCTCGTACTCTCTGTCGGCCATTTTGCTCCAGCAACAAACAGAAAAGGAAGCGATT
CGGGAAGCAGCCACCGCCAAGCACAAAATGCAAGAGATCCAAGCCGAGCAGGAGTTCCAGCAGTGGTGGGACCAA
GAAAGTAAGCGTGTGCAAGGATTGGTAGACCCGGAGCCAAATGAACCTCGCCCTGGAAAGGGTGGACGAGGCGGC
AAGACATCTAGCGCTGCCAGTGGCCCGCGTAAGCGTCGAGCCAACAAAAACACCGGTGATGGACCTGCTCCTCAA
GATCACAGGCGCGTATCGGCTCCAGGCTCTGGGCATACAAACCCCAAGACGAATCAGAGTGGTCAGGCCCCAGCT
CAGTCTCAAAGAGCACCGAATAAAAATCGTGCTGGAGATGTTTCTGGGAATGCCAATGGTCGCCGTGGAGGCGGC
AATCAACGCGGTAGGGGCAAGAACGACGCATAA
Transcript >Pro_DTO377G3_2|g5677.t1
ATGAGTAATAAGCTTTGGGAGTGTTTCATTCAAGATGATGTCGAGCGGTTCCAGCGGTCTCTGGCGAACGCGACG
TTCGCGGGCCCGCGAGCTGCCGGAGGCTCAGGAGGGACCTCCAGAGCTGCGACAAACCTGTCATCGAAAGCTGGA
AGCCCTGGGTCCATGATTGCTTCGTCTCCAAATATACCGAGAAATAAAAAGAATATCGCATCATCCCCTGGGGCC
TTTGTGCCTGACCGGGCGGCCTTACCGCGTGGGAGCGCGACTTTGTCGCGTGCCGATGTTAACGCCCGTGATCAT
TACGGCCGTACACTGCTGCACCATGTCGCTTCGTCCTCGAGACCTACCGCGTCCAAATTTGCACGTGCTTTGTTA
GAAGTTCCGTTTATCGATATATATGCGCAGGACTGGGAGAGTGGGTGGACGGCTCTGCATCGGGCTCTTTATGCC
GGGAACGCCACAATTGCTCTGGCGCTCATGGCGCGCGATCTGCAGGACATGACAGATTTCAGCAAAGGTGGAAAT
ACGAGCCATCCAAGTGGTGGCCTTATCAAGATCAAGGATCGTGAGGGTTGCAGTCCTTTTGATGTCTTCGGGGCG
ACTATTAGAGCCCGCGACATTAAGCATATCTCTGAAAACTGGCCAAGTTCATATAATGATGATGATGCCCTCGGC
AGCGATGTTGCTTCCAATGCTGCGTCGAACTTCGGAGATGATGGGGAAGATGGGGCATACACTCTTAGGAGTGTC
CTGAAAGGGGCCGTGGATCTTGCCGCCGATGAAGTCTTCACATTAGGAAGCAACAAAAACCTGAACCTTGGTTTA
GGGGATCAGGATGACAGACAATTTCCTGAGCGCATCTCATTGAAGCGCCCTGAGCATCTTTTGCATCGATTTTAT
CGTGAATATCACGAGAAATTGGAACACCTAGGGCTCGAAGATACCGTGCCTAAGACCAAAACGACCGAGCTGCCC
ACTTTGATCACAAACAAGCCAATGAAGTTCCAAGACATTATTATGTCCAAACTGCATACTGCCATAATCACAGAT
GACCCCGAGGCTAATCTGTTCATGTGTGGATTCGGTCCTGGAGGGCGCCTAGGAACGGGAGATGAGTCGACGCGT
TTCACCTTTGCTTGTATTGAGACAGGTGGACTAGAGGGGAAGAAAGTCTTATCGGCTGCTCTGGGTCAAGACCAT
AGCCTGGCAATCACCGAGCAGGGTGAGATCTTCAGCTGGGGAAGCAACAAGTTCGGACAACTTGGCTATGGCCTT
CCTAGGACTAGCAACAAAAACGACATTCCCATCCAGACGACTCCTCGCCAGATTTTCAATCCGTTCAAGAAAGAG
ACGATCATAGGTGCAGCAGCGTCATCTATTCACTCGGTGGTCTTCAGTACCTCTGGTCTCTATACGTTTGGCAAG
AACGAAGGTCAACTTGGCTTGGTCGATTCCGATGCGCGTTCGCTTGAGATACAAACGACACCACGGCGCGTTGGA
GCATCTCTTTTCAGTTGTCCAATCAAGATGGTGTCCGCCATTGACCGTGCTACGTCTGTGCTTCTGCAGAACCAC
GAAGTTTGGGTTTTCTCATCATATGGCTATTCAAAGCTTTCATTCCCACTAGAAGTGAGCTCCAGATTTATCAGG
GATAGCTTCATGGCAACCAGATACGACAAGACTGCAAACCGTGTTGTCAAGATTGTGTGTGGAGGCAACACCATA
TGTGCATTATCCAGCTCTGGTGATGTATTCACTGTTCAAGCCAACCAGTCCGATAACTCTTCGGCTTTAACGTCC
ACAACCAATCCTGCAAAGATTCGAAATTCATTAGCCGCCCCTGTTAAAGCATGGTCCGTTAAGAAATCATACATG
GCAGCGAGTGATGTTGATGTTGGACAAGACGGATCGATTATCATCTGTACAACATCTGGATCTGCGTGGAGAAAA
GAACGGCGGACAAAGAACAAGGAGGGAGCGTCGAAAGAATATAAATTTGCCCGCATACCTGGTCTCTCACGGGCA
GTGGCAGTGCGCAGCAATGCGTTTGGGGCCTACGCCGTGGCTCAACGTGACTGCGAAGTGACCAGGGAACAAATT
AATGTCGAGCAAAGCAGCCTTTGGGATGATATGTTGCCGTTGTCCCCGTTTTCAACCCCAGGTCTGGAAGAGTTG
GACTCGATCCTCGAAGATGACGCTAAGAATATCCCTCTTGTACTTTCATCCGGAAAAAGCATCCAAAGAGCCATC
CTTTCATCATCGGATATTGAAAGCCAATTTCTTTCTGTACGGAGCGAGGGGACTGTTTGGGTGACCAGCTCCCTA
TCCGACTCTTGTATTCCTGTTCATGAATTTCTCATAGCTGGCCGCATTCCTATTCTTGGAAAGGCATTGGCCGAG
TTCCGCCAGTCATATTATTCATCCGTCCCCGACGTTTTTGGTATTGAATACGGGAAGGACGGACATCCGCAGATC
TGCCTTCAAGGTGTTGATTTTTTGACCGTTATGAACGTGGTCTTTTTCCTTTACACAGACGGTATTCTCGATGTC
TGGCGCCTGGCAAGGAGCTCGCCCGCAAACTCGGCCCGTTTCCGGCAGGTTCGCACTGAAGTTATGCGGGTTTCT
ATGCAACTAGGCCTGCCAGCGCTGGAGCGGGCAGCACGACTAATGGTCGAGCCGCAAAGGAGCCTGAAAATCGAC
ATGGCCCATGCCATCAATCACTCGTTCTTATTTGACAGCGCAGACGTGACTCTTCAGCTCAAAGGCGATACAATC
AAAGTGCACAGTCAAGTCGTGTGCCAGAGATGTCCGTTCTTTGACACACTCTTCCATGGTCATGCGGGTGGAAGG
TGGCTAGACTCGCGCAAGGCGGACCCAAACCAGAGCGTGCATGTCGACCTAAAGCACATTGATCGCTCGACATTT
GAATTCGTCCTGCGTTACCTATATGCCGATACGGAAGACCGACTGTTTGATGAAGTACGGATTGGAGATGTTGAT
GATTTCATTGACTTGCTTCTGGATGTCATGTTCGTGGCAAATGAGCTGATGATCGACCGACTATCTCAAGTATGT
CAGAAGATGCTCGGTCGTTTCGTCACAACGCGAAACGTGTGCTATTTGCTCAATTCAATTGCCCCTTGCTGTGTC
ACAGAGTTCAAGGATGCTGCCCTGGAATATATCTGTCTAAATCTCGAGGCCATGCTCGCTAACAGATATCTCGAA
GATCTGGATCCTACTCTGCTTTGGGAGTTGGATCTGATCTGTCACGAAAATCAGTTGGCGTGCTGGCCCATATCC
CGTGGGCGCAATTCTGAGGAGTATGTCTTCGAGAAATACCCCGAACTTGTCAGCTCCGTGGAAGCAGATAAGCAA
CGAAGGATCGATGCCATGACTTTGCAGTCCCGCCTTGGTCGTTTCGAGCCGTATGACGATGCGCGAACCCGGTCA
ATGCATAACGAGAAGGGTACCTCATCTCCGTCTGCACGCAAGGCGAAGAACAGTGTATCCCGGGAGTCACCAAAT
GTTGGTAATAGCCCAATGCTGAAGTCGAGACCGTCGGTTGGTGATCTCATGTTTCAAATGGACGACGAGGCCCTC
ATATCACCAAGTGCTTCGAAAGGCAAGGGTGTCATGCGTGAACTCAGGTTCACAGAAGGCATACCTGAAAATCAA
TCATACCCTGACTCCCCAGCTTTGGGGGCAAGCGTCCCAGAGGCCGAGTCCTTCGGTGAGTATGGTTTCTTGAAG
GATCAGATGTCTTCCCCACAAGATCCGCTACTACAGTCCCCATCTGAGTCCAGGGCGATGACAAAAAACCAAAAA
GAAGCCCTAGCATCGTCATCTAATCCCTCTTCTGCGCCATGGACCTCGCCAATGATTTCTAGTTCCAAGAAGGAT
ATCAAAGACATCATGGGAGAAGCATTACAGTCTCGGGTATCCAATCTCACGCTAGGCATGGCAGATCGACGCGAA
AGCAGCGGTAACTTCGTGCCTAAGATCTCTCAGAAGGAGCGAAAGAAGCTTCAGCAACAACAGATACAAGATCAG
CTGGCTGCCCAGCAGAAGGCGAAGGAGGCACCACAGAACCCCTGGCAAAAGCCAGCAGCTTCTTCTCCAGCGTCG
CTCCCTAAACTCGACCCTCTCCCAGGTCAAAGCGCCCCAGCATCTCAGGCTGTTAAATCATCACCTCAAAGGTCC
ATGACTATGCGGCAGACTGTGGCTGGCACGCCGCCGTCAAAGTCAAAGACAGTGGCTACACCCGTGCAAACACAA
CGCCGTAGTGTGTCAGGGAACCCACAGCCCTATTCTCATTCGAAACCTTCCGTATCGGGACCTTCTACAGTACCT
CCCAACAATCAACCATCATCACCACAGCCAGTCATCCAGTCAATTCGTCACATCCCACGCCCTGACCTAACAGGA
TCACGCTCTTCACCCTCTGGCTCGTACTCTCTGTCGGCCATTTTGCTCCAGCAACAAACAGAAAAGGAAGCGATT
CGGGAAGCAGCCACCGCCAAGCACAAAATGCAAGAGATCCAAGCCGAGCAGGAGTTCCAGCAGTGGTGGGACCAA
GAAAGTAAGCGTGTGCAAGGATTGGTAGACCCGGAGCCAAATGAACCTCGCCCTGGAAAGGGTGGACGAGGCGGC
AAGACATCTAGCGCTGCCAGTGGCCCGCGTAAGCGTCGAGCCAACAAAAACACCGGTGATGGACCTGCTCCTCAA
GATCACAGGCGCGTATCGGCTCCAGGCTCTGGGCATACAAACCCCAAGACGAATCAGAGTGGTCAGGCCCCAGCT
CAGTCTCAAAGAGCACCGAATAAAAATCGTGCTGGAGATGTTTCTGGGAATGCCAATGGTCGCCGTGGAGGCGGC
AATCAACGCGGTAGGGGCAAGAACGACGCATAA
Gene >Pro_DTO377G3_2|g5677.t1
ATGAGTAATAAGCTTTGGGAGTGTTTCATTCAAGATGATGTCGAGCGGTTCCAGCGGTCTCTGGCGAACGCGACG
TTCGCGGGCCCGCGAGCTGCCGGAGGCTCAGGAGGGACCTCCAGAGCTGCGACAAACCTGTCATCGAAAGCTGGA
AGCCCTGGGTCCATGATTGCTTCGTCTCCAAATATACCGAGAAATAAAAAGAATATCGCATCATCCCCTGGGGCC
TTTGTGCCTGACCGGGCGGCCTTACCGCGTGGGAGCGCGACTTTGTCGCGTGCCGATGTTAACGCCCGTGATCAT
TACGGCCGTACACTGCTGCACCATGTCGCTTCGTCCTCGAGACCTACCGCGTCCAAATTTGCACGTGCTTTGTTA
GAAGTTCCGTTTATCGATATATATGCGCAGGACTGGGAGAGTGGGTGGACGGCTCTGCATCGGGCTCTTTATGCC
GGGAACGCCACAATTGCTCTGGCGCTCATGGCGCGCGATCTGCAGGACATGACAGATTTCAGCAAAGGTGGAAAT
ACGAGCCATCCAAGTGGTGGCCTTATCAAGATCAAGGATCGTGAGGGTTGCAGTCCTTTTGATGTCTTCGGGGCG
ACTATTAGAGCCCGCGACATTAAGCATATCTCTGAAAACTGGCCAAGTTCATATAATGATGATGATGCCCTCGGC
AGCGATGTTGCTTCCAATGCTGCGTCGAACTTCGGAGATGATGGGGAAGATGGGGCATACACTCTTAGGAGTGTC
CTGAAAGGGGCCGTGGATCTTGCCGCCGATGAAGTCTTCACATTAGGAAGCAACAAAAACCTGAACCTTGGTTTA
GGGGATCAGGATGACAGACAATTTCCTGAGCGCATCTCATTGAAGCGCCCTGAGCATCTTTTGCATCGATTTTAT
CGTGAATATCACGAGAAATTGGAACACCTAGGGCTCGAAGATACCGTGCCTAAGACCAAAACGACCGAGCTGCCC
ACTTTGATCACAAACAAGCCAATGAAGTTCCAAGACATTATTATGTCCAAACTGCATACTGCCATAATCACAGAT
GACCCCGAGGCTAATCTGTTCATGTGTGGATTCGGTCCTGGAGGGCGCCTAGGAACGGGAGATGAGTCGACGCGT
TTCACCTTTGCTTGTATTGAGACAGGTGGACTAGAGGGGAAGAAAGTCTTATCGGCTGCTCTGGGTCAAGACCAT
AGCCTGGCAATCACCGAGCAGGGTGAGATCTTCAGCTGGGGAAGCAACAAGTTCGGACAACTTGGCTATGGCCTT
CCTAGGACTAGCAACAAAAACGACATTCCCATCCAGACGACTCCTCGCCAGATTTTCAATCCGTTCAAGAAAGAG
ACGATCATAGGTGCAGCAGCGTCATCTATTCACTCGGTGGTCTTCAGTACCTCTGGTCTCTATACGTTTGGCAAG
AACGAAGGTCAACTTGGCTTGGTCGATTCCGATGCGCGTTCGCTTGAGATACAAACGACACCACGGCGCGTTGGA
GCATCTCTTTTCAGTTGTCCAATCAAGATGGTGTCCGCCATTGACCGTGCTACGTCTGTGCTTCTGCAGAACCAC
GAAGTTTGGGTTTTCTCATCATATGGCTATTCAAAGCTTTCATTCCCACTAGAAGTGAGCTCCAGATTTATCAGG
GATAGCTTCATGGCAACCAGATACGACAAGACTGCAAACCGTGTTGTCAAGATTGTGTGTGGAGGCAACACCATA
TGTGCATTATCCAGCTCTGGTGATGTATTCACTGTTCAAGCCAACCAGTCCGATAACTCTTCGGCTTTAACGTCC
ACAACCAATCCTGCAAAGATTCGAAATTCATTAGCCGCCCCTGTTAAAGCATGGTCCGTTAAGAAATCATACATG
GCAGCGAGTGATGTTGATGTTGGACAAGACGGATCGATTATCATCTGTACAACATCTGGATCTGCGTGGAGAAAA
GAACGGCGGACAAAGAACAAGGAGGGAGCGTCGAAAGAATATAAATTTGCCCGCATACCTGGTCTCTCACGGGCA
GTGGCAGTGCGCAGCAATGCGTTTGGGGCCTACGCCGTGGCTCAACGTGACTGCGAAGTGACCAGGGAACAAATT
AATGTCGAGCAAAGCAGCCTTTGGGATGATATGTTGCCGTTGTCCCCGTTTTCAACCCCAGGTCTGGAAGAGTTG
GACTCGATCCTCGAAGATGACGCTAAGAATATCCCTCTTGTACTTTCATCCGGAAAAAGCATCCAAAGAGCCATC
CTTTCATCATCGGATATTGAAAGCCAATTTCTTTCTGTACGGAGCGAGGGGACTGTTTGGGTGACCAGCTCCCTA
TCCGACTCTTGTATTCCTGTTCATGAATTTCTCATAGCTGGCCGCATTCCTATTCTTGGAAAGGCATTGGCCGAG
TTCCGCCAGTCATATTATTCATCCGTCCCCGACGTTTTTGGTATTGAATACGGGAAGGACGGACATCCGCAGATC
TGCCTTCAAGGTGTTGATTTTTTGACCGTTATGAACGTGGTCTTTTTCCTTTACACAGACGGTATTCTCGATGTC
TGGCGCCTGGCAAGGAGCTCGCCCGCAAACTCGGCCCGTTTCCGGCAGGTTCGCACTGAAGTTATGCGGGTTTCT
ATGCAACTAGGCCTGCCAGCGCTGGAGCGGGCAGCACGACTAATGGTCGAGCCGCAAAGGAGCCTGAAAATCGAC
ATGGCCCATGCCATCAATCACTCGTTCTTATTTGACAGCGCAGACGTGACTCTTCAGCTCAAAGGCGATACAATC
AAAGTGCACAGTCAAGTCGTGTGCCAGAGATGTCCGTTCTTTGACACACTCTTCCATGGTCATGCGGGTGGAAGG
TGGCTAGACTCGCGCAAGGCGGACCCAAACCAGAGCGTGCATGTCGACCTAAAGCACATTGATCGCTCGACATTT
GAATTCGTCCTGCGTTACCTATATGCCGATACGGAAGACCGACTGTTTGATGAAGTACGGATTGGAGATGTTGAT
GATTTCATTGACTTGCTTCTGGATGTCATGTTCGTGGCAAATGAGCTGATGATCGACCGACTATCTCAAGTATGT
CAGAAGATGCTCGGTCGTTTCGTCACAACGCGAAACGTGTGCTATTTGCTCAATTCAATTGCCCCTTGCTGTGTC
ACAGAGTTCAAGGATGCTGCCCTGGAATATATCTGTCTAAATCTCGAGGCCATGCTCGCTAACAGATATCTCGAA
GATCTGGATCCTACTCTGCTTTGGGAGTTGGATCTGATCTGTCACGAAAATCAGTTGGCGTGCTGGCCCATATCC
CGTGGGCGCAATTCTGAGGAGTATGTCTTCGAGAAATACCCCGAACTTGTCAGCTCCGTGGAAGCAGATAAGCAA
CGAAGGATCGATGCCATGACTTTGCAGTCCCGCCTTGGTCGTTTCGAGCCGTATGACGATGCGCGAACCCGGTCA
ATGCATAACGAGAAGGGTACCTCATCTCCGTCTGCACGCAAGGCGAAGAACAGTGTATCCCGGGAGTCACCAAAT
GTTGGTAATAGCCCAATGCTGAAGTCGAGACCGTCGGTTGGTGATCTCATGTTTCAAATGGACGACGAGGCCCTC
ATATCACCAAGTGCTTCGAAAGGCAAGGGTGTCATGCGTGAACTCAGGTTCACAGAAGGCATACCTGAAAATCAA
TCATACCCTGACTCCCCAGCTTTGGGGGCAAGCGTCCCAGAGGCCGAGTCCTTCGGTGAGTATGGTTTCTTGAAG
GATCAGATGTCTTCCCCACAAGATCCGCTACTACAGTCCCCATCTGAGTCCAGGGCGATGACAAAAAACCAAAAA
GAAGCCCTAGCATCGTCATCTAATCCCTCTTCTGCGCCATGGACCTCGCCAATGATTTCTAGTTCCAAGAAGGAT
ATCAAAGACATCATGGGAGAAGCATTACAGTCTCGGGTATCCAATCTCACGCTAGGCATGGCAGATCGACGCGAA
AGCAGCGGTAACTTCGTGCCTAAGATCTCTCAGAAGGAGCGAAAGAAGCTTCAGCAACAACAGATACAAGATCAG
CTGGCTGCCCAGCAGAAGGCGAAGGAGGCACCACAGAACCCCTGGCAAAAGCCAGCAGCTTCTTCTCCAGCGTCG
CTCCCTAAACTCGACCCTCTCCCAGGTCAAAGCGCCCCAGCATCTCAGGCTGTTAAATCATCACCTCAAAGGTCC
ATGACTATGCGGCAGACTGTGGCTGGCACGCCGCCGTCAAAGTCAAAGACAGTGGCTACACCCGTGCAAACACAA
CGCCGTAGTGTGTCAGGGAACCCACAGCCCTATTCTCATTCGAAACCTTCCGTATCGGGACCTTCTACAGTACCT
CCCAACAATCAACCATCATCACCACAGCCAGTCATCCAGTCAATTCGTCACATCCCACGCCCTGACCTAACAGGA
TCACGCTCTTCACCCTCTGGCTCGTACTCTCTGTCGGCCATTTTGCTCCAGCAACAAACAGAAAAGGAAGCGATT
CGGGAAGCAGCCACCGCCAAGCACAAAATGCAAGAGATCCAAGCCGAGCAGGAGTTCCAGCAGTGGTGGGACCAA
GAAAGTAAGCGTGTGCAAGGATTGGTAGACCCGGAGCCAAATGAACCTCGCCCTGGAAAGGGTGGACGAGGCGGC
AAGACATCTAGCGCTGCCAGTGGCCCGCGTAAGCGTCGAGCCAACAAAAACACCGGTGATGGACCTGCTCCTCAA
GATCACAGGCGCGTATCGGCTCCAGGCTCTGGGCATACAAACCCCAAGACGAATCAGAGTGGTCAGGCCCCAGCT
CAGTCTCAAAGAGCACCGAATAAAAATCGTGCTGGAGATGTTTCTGGGAATGCCAATGGTCGCCGTGGAGGCGGC
AATCAACGCGGTAGGGGCAAGAACGACGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail