Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5673.t1
Gene name
Locationscaffold_14:98158..103765
Strand-
Gene length (bp)5607
Transcript length (bp)4410
Coding sequence length (bp)4410
Protein length (aa) 1470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10033 ATG13 Autophagy-related protein 13 4.5E-74 574 813
PF03583 LIP Secretory lipase 5.7E-58 132 414

GO

GO Term Description Terminal node
GO:1990316 Atg1/ULK1 kinase complex Yes
GO:0016042 lipid catabolic process Yes
GO:0004806 triglyceride lipase activity Yes
GO:0006914 autophagy Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0052689 carboxylic ester hydrolase activity No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0032991 protein-containing complex No
GO:1990234 transferase complex No
GO:0044248 cellular catabolic process No
GO:1902554 serine/threonine protein kinase complex No
GO:1902494 catalytic complex No
GO:0061919 process utilizing autophagic mechanism No
GO:1901575 organic substance catabolic process No
GO:0016787 hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0016298 lipase activity No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:1902911 protein kinase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5673.t1
MALSLALMVRLALVGLVVFTSIASALPAPQVPRSTVQDPDTDPFYQPPAGFASEAPGTILSQRNITAAFFGLVPV
DVEAYQLLYRTTAINGSAIATVTTVFKPKDAKLDRFVSFATAYDSSATKCQPSYTYQLGSPQDSLIASVELLIID
IYLALGYTVASPDYEGPEAAFGPGRLAGMGVLDGIRAVKSFKTLSLTDDPMVVGIGYSGGAIATGWAASLQPLYA
SELNIKGWAQGGTPANVTGTMYQLDNTAFSGLLPPAIAGLIKPSAYGASLGPFISEIITAEGQQILDAAVAECAT
ADIAAFFERSIFDTSFQTLGENFIFDPIAQSVLKQNTMAANEDETPTAPTFVYHATDDEVIPYADAKTMVNSWCN
WSANVKFTTYASGGHATTEIIAIPDVINFVQDAFAGTTASGCTTNTELGSILNPLALGVDLEPILVELIDALFNL
GDQDSKVKNDPVGHGPQSWIHRCPIAFLITDSGGDNTHIQHSPKTTMHQHPRSSAVPSPPPNLPPRPTARDVRRE
QETAPSSPTVDMGSNYARGLGLEPGPQPSEQGRNAALGKEALTRLNQIISNYHTKAALIILHSRVALPPSFNKGS
DSPRVNRWFNVELDDTDVLREPLRPWRTCDATDNRPPPLVIETYLDTKGLTNNQSLVIIDENGKRWDVRESLAAL
QGARAKPYQSENDEIILERWKIELGECSSRPPADLGSILPTVYKKSIVLFRSLFTYSKFLPAWRFSRRNKKLRQS
PALQIKYRVVDGSAARDNLPLDHLTAPLSEGSEKVVDTYGFGVTESPAGPFSVQVTYRTNCDFRVDDSEALLSSR
FMGADDEIFRPSLPSDDVNRPNPEVGSVPVERRAVESPDCTRAYGSLSTFHQVGPTTGASPISALRAMRDSGAGS
PSPTESPKRLLPSAKVLPSGRAAQIAGESGGSSFPRRPSVSFQPFKAPSLSASPALADSPLGMSPRNTSRISTGT
SADSRVMPPLSSAASARRPITIASEQAISSSNSASPKPAPISRYSSSFSHRRGRLSVGTNRLEDDNSSGRASATS
SNAQPGSGLLTEATGTSAESIHADDENISDFLKMLDSKKDLMNSSTASLQPGPRQANPTAVALARFRGMRDSNAA
LSDSMSQSMHMHRSSLSSSKQLSGVPPMVAGTSVSTASSPGKPISPHTPHTPAIRSRLSSNSVADDIETDHRSRI
PRSHHDPPLEEHSSAENTRGASSTAGAIDIPTSPRIFDPAYRRSSSAAVRRPVVTSDDDEIFPFGMRSLSLGADE
PSHATLAAAQQHTESLKSQQSPAEGRSGPSRSAAGPYRDSASLRGQMSGPTSASASSNPHVYQPRFASSRGRGYS
GGHSVSSASSSLARGANPAPHLVERDHDRDGNASGSNSGNSTLEIRRGSGQRPGAVRTLSGQAPEDDEPLLFAMS
DFGVSRRSLDEVRHGNHGGAESAAGSRRGSGRRGAGLPGFHVWS*
Coding >Pro_DTO377G3_2|g5673.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAGCCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATAGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATCCGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCAGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGACGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGACATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATT
GCGTTCCTGATAACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGAAGACCACCATGCATCAACAT
CCCCGATCATCGGCGGTGCCGTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAA
CAGGAAACCGCCCCGAGCTCCCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGATTAGAGCCGGGA
CCTCAACCGTCCGAGCAGGGGAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCG
AACTATCACACAAAAGCCGCTTTGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCC
GATTCTCCTAGAGTCAACCGCTGGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCT
TGGAGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACGTACTTAGACACAAAGGGCCTC
ACAAATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTT
CAGGGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGA
GAGTGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTC
CGTTCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGT
CCGGCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACA
GCCCCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCC
TTCTCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGG
TTTATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTC
GGTTCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTT
CATCAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCT
CCTTCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATT
GCTGGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCTCTCTG
TCTGCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGCATCTCCACAGGTACA
TCTGCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAA
CAAGCTATATCATCCTCTAATTCCGCATCCCCCAAGCCTGCTCCGATATCCCGTTACAGCAGCTCCTTTAGCCAC
CGACGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCA
TCCAATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGAC
GAGAATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAA
CCTGGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCG
TTGTCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTC
CCACCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCAC
ACGCCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATC
CCTCGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCA
GGGGCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGC
CGGCCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAG
CCCTCTCACGCCACCCTAGCTGCCGCCCAACAGCACACCGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGT
CGAAGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCA
ACCAGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCG
GGCGGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGC
GACCATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGG
CAGCGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGC
GACTTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGG
TCCCGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA
Transcript >Pro_DTO377G3_2|g5673.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAGCCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATAGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATCCGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCAGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGACGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGACATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATT
GCGTTCCTGATAACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGAAGACCACCATGCATCAACAT
CCCCGATCATCGGCGGTGCCGTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAA
CAGGAAACCGCCCCGAGCTCCCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGATTAGAGCCGGGA
CCTCAACCGTCCGAGCAGGGGAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCG
AACTATCACACAAAAGCCGCTTTGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCC
GATTCTCCTAGAGTCAACCGCTGGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCT
TGGAGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACGTACTTAGACACAAAGGGCCTC
ACAAATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTT
CAGGGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGA
GAGTGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTC
CGTTCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGT
CCGGCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACA
GCCCCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCC
TTCTCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGG
TTTATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTC
GGTTCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTT
CATCAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCT
CCTTCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATT
GCTGGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCTCTCTG
TCTGCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGCATCTCCACAGGTACA
TCTGCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAA
CAAGCTATATCATCCTCTAATTCCGCATCCCCCAAGCCTGCTCCGATATCCCGTTACAGCAGCTCCTTTAGCCAC
CGACGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCA
TCCAATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGAC
GAGAATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAA
CCTGGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCG
TTGTCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTC
CCACCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCAC
ACGCCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATC
CCTCGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCA
GGGGCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGC
CGGCCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAG
CCCTCTCACGCCACCCTAGCTGCCGCCCAACAGCACACCGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGT
CGAAGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCA
ACCAGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCG
GGCGGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGC
GACCATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGG
CAGCGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGC
GACTTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGG
TCCCGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA
Gene >Pro_DTO377G3_2|g5673.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAGCCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATAGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATCCGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCAGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGACGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGAGTGCTCGGCACAAGCCTTTAAGCGAATGCTGACATC
TATTATCATTGGTCCTGATGAGCGTTGAGGGTTTGAGCCGCAACTGTTTCTGATATGCACATGGTTATTCGCTCT
GCCACCTTTGGTGTCTTTGTTTCCTTTGGCTAGGCTTTGGTATCCTTTGTGGGACATTATAACCTTTTCTGTCAG
CACATAATGTTTCTCACCAACAATGAGAAGGCAGACTTCCGAGTCGAGCTTGTGTTGATCAATGGAATGAAGTCC
ACAGGATATGACGTTGGATCAGATAACGGTGTGACCTGCCAAAATATAGTATGGGGAAATCTTGGAAGATGTCAA
AGTACTCAGATATAAAGGATCCATCAGCTGCCTATACCTGGCTGTCTGTAGCCTCCAAGTAGAACGTCTTGATAT
CACGCCTTGTAAGTCGTGATCAAGCGCTTATCGGTTCCAGGGGACCTTGCCCCGGGTACGGCGATCCTTGCGACC
GTGCATGACACCCGGCTTGTCCAACAGCCTGTTTCCAGGTAAAAGGAAGTTATACAAGTGAAAGGAGAACAGGAG
CCTAGTTTATCAAGAAGATAGGCAGCCAACCCCCCGTGTTTGCATCATCTGTGTGGCGTTCTAGGCTGACTAGGA
CACTCGAGACCTGTCGAGTCACCGGATGTGCGTCACAGACGAACTATCTTCATTATCACACCCCTTCTCTCTCTC
TTTCTCCGCATCCACCTGCTTTCTCATTCTTTTCTTACGAGCTTTATCATATTTCTCTCGCTTCTCTACACCCCT
CACGGTGATTTTATCCAACTGCATTTGCCCGTGCGGAGAAGCTCTAGACCTGCCCCGAAGGTCCCAGGCCGGAGT
CAACCCCAGACCACATGCTAGGCGCCCATTGTCTCATTGTGAATCATTTAGCGTCTCAGATTCAGGAACATTCTT
AGAAGATTATCATCACCTTCTCTGTTAGCATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATTGCGTTCCTGAT
AACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGGTAATGCCGTTCTTACCTCTTGTTCGCATGCA
TGTCGATGGTCGCTAACCACGGTGTCGCAACTAGAAGACCACCATGCATCAACATCCCCGATCATCGGCGGTGCC
GTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAACAGGAAACCGCCCCGAGCTC
CCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGATTAGAGCCGGGACCTCAACCGTCCGAGCAGGG
GAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCGGTATCGTCATTCAGATCGCC
CCTCTCATGGCTTATCAGGATAGCTCATTGACGGCTAATCTCCTTTTCAACAGAACTATCACACAAAAGCCGCTT
TGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCCGATTCTCCTAGAGTCAACCGCT
GGGTATGTTTCCAAGTCATGGTCGGATTCGCGATGCTTTTTGGGATATCAAGGCACATGAAAGTGGCAGGCGCTA
ACTCTGTTTGTTTCCCTCCAGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCTTGG
AGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACGTACTTAGACACAAAGGGCCTCACA
AATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTTCAG
GGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGAGAG
TGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTCCGT
TCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGTCCG
GCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACAGCC
CCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCCTTC
TCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGGTTT
ATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTCGGT
TCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTTCAT
CAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCTCCT
TCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATTGCT
GGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCTCTCTGTCT
GCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGCATCTCCACAGGTACATCT
GCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAACAA
GCTATATCATCCTCTAATTCCGCATCCCCCAAGCCTGCTCCGATATCCCGTTACAGCAGCTCCTTTAGCCACCGA
CGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCATCC
AATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGACGAG
AATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAACCT
GGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCGTTG
TCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTCCCA
CCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCACACG
CCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATCCCT
CGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCAGGG
GCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGCCGG
CCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAGCCC
TCTCACGCCACCCTAGCTGCCGCCCAACAGCACACCGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGTCGA
AGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCAACC
AGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCGGGC
GGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGCGAC
CATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGGCAG
CGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGCGAC
TTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGGTCC
CGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail