Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5670.t1
Gene name
Locationscaffold_14:89359..90418
Strand-
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.8E-15 222 291

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 90.79 54.82 126.76
5d_25C Five days - 25 degrees Celsius 101.08 61.41 140.76
7d_25C Seven days - 25 degrees Celsius 93.17 56.45 129.89
10d_25C Ten days - 25 degrees Celsius 99.55 60.47 138.63
7d_15C Seven days - 15 degrees Celsius 129.06 78.59 179.54
7d_30C Seven days - 30 degrees Celsius 92.28 55.87 128.70

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.706697 no
3d_25C 7d_25C 0.940770 no
3d_25C 7d_15C 0.106340 no
3d_25C 7d_30C 0.964042 no
3d_25C 10d_25C 0.753975 no
5d_25C 7d_25C 0.785901 no
5d_25C 7d_15C 0.309840 no
5d_25C 7d_30C 0.761996 no
5d_25C 10d_25C 0.966550 no
7d_25C 7d_15C 0.143776 no
7d_25C 7d_30C 0.979717 no
7d_25C 10d_25C 0.835134 no
7d_15C 7d_30C 0.127487 no
7d_15C 10d_25C 0.262162 no
7d_30C 10d_25C 0.805171 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5670.t1
MSLPPPPGLKQTPSSLPPRPPPSSNAAQPPTANPAGYGGRPRPTGYNAFTAFQPRAVASSQPRRPNNYSVANPPV
SAGYATPVKSYVNQYQQPQTYQSGPSYYGQPQYAENTYGPTVPHITNPFGSTPNTGFSQGGNAPGFDAETEAQIA
QWQSAYNRPTDDPKNQGNQPGSGVNTGAGTPTLGAGTPAQQAESQKTVIRSGGGQTWTDSTLLEWDPAHFRLFVG
NLAGEVTDESLLKAFASYTSVQKARVVREKRTQKSLGYGFVSFSGSDDYFKAAREMHGKYIGSHPILLRRAVTEV
RPTSAPKHGKHGKKQGKGKGPKGDNAGGAGGKVKQDGIKKPAKTKGGLKILG*
Coding >Pro_DTO377G3_2|g5670.t1
ATGTCCCTTCCGCCTCCTCCAGGTCTCAAACAGACTCCCTCGTCACTTCCGCCCCGCCCACCTCCATCCTCCAAT
GCCGCGCAGCCTCCCACCGCCAATCCTGCAGGCTATGGCGGTAGACCTCGACCAACGGGCTACAACGCCTTCACG
GCGTTCCAGCCGCGCGCGGTAGCCTCCAGTCAACCGCGTCGCCCCAACAACTACTCGGTCGCGAATCCGCCAGTC
TCTGCTGGATACGCAACCCCCGTCAAGAGCTACGTCAATCAATATCAACAACCTCAGACATACCAAAGTGGGCCT
TCCTACTATGGACAACCTCAATACGCTGAAAACACATACGGCCCGACCGTCCCACATATTACGAACCCGTTCGGA
TCTACGCCCAATACAGGGTTTTCACAGGGTGGCAACGCCCCCGGATTTGACGCAGAGACGGAAGCTCAAATCGCG
CAGTGGCAGAGCGCCTACAATAGGCCCACCGATGACCCCAAGAATCAAGGCAACCAGCCGGGTTCAGGCGTGAAC
ACGGGAGCTGGAACCCCAACCCTCGGCGCTGGCACTCCTGCCCAGCAGGCCGAGTCACAAAAAACAGTTATTCGC
TCTGGTGGTGGTCAGACATGGACCGACTCGACCCTATTGGAGTGGGACCCGGCACATTTCCGACTTTTTGTGGGT
AACCTCGCAGGTGAAGTGACGGATGAGTCTCTACTGAAGGCATTCGCCTCCTACACATCGGTCCAGAAAGCTCGT
GTCGTCCGAGAGAAACGAACCCAGAAGAGCTTAGGCTATGGGTTCGTCAGTTTCAGTGGAAGTGACGACTACTTC
AAAGCGGCACGAGAAATGCATGGCAAGTACATTGGTTCGCACCCAATCCTACTGCGCCGAGCGGTAACCGAGGTT
CGCCCAACTTCGGCCCCCAAGCATGGAAAGCATGGAAAGAAACAAGGCAAGGGCAAGGGTCCTAAGGGAGACAAC
GCCGGTGGCGCAGGTGGAAAAGTGAAGCAGGACGGTATCAAAAAGCCAGCCAAAACGAAGGGAGGATTGAAGATT
CTGGGTTAA
Transcript >Pro_DTO377G3_2|g5670.t1
ATGTCCCTTCCGCCTCCTCCAGGTCTCAAACAGACTCCCTCGTCACTTCCGCCCCGCCCACCTCCATCCTCCAAT
GCCGCGCAGCCTCCCACCGCCAATCCTGCAGGCTATGGCGGTAGACCTCGACCAACGGGCTACAACGCCTTCACG
GCGTTCCAGCCGCGCGCGGTAGCCTCCAGTCAACCGCGTCGCCCCAACAACTACTCGGTCGCGAATCCGCCAGTC
TCTGCTGGATACGCAACCCCCGTCAAGAGCTACGTCAATCAATATCAACAACCTCAGACATACCAAAGTGGGCCT
TCCTACTATGGACAACCTCAATACGCTGAAAACACATACGGCCCGACCGTCCCACATATTACGAACCCGTTCGGA
TCTACGCCCAATACAGGGTTTTCACAGGGTGGCAACGCCCCCGGATTTGACGCAGAGACGGAAGCTCAAATCGCG
CAGTGGCAGAGCGCCTACAATAGGCCCACCGATGACCCCAAGAATCAAGGCAACCAGCCGGGTTCAGGCGTGAAC
ACGGGAGCTGGAACCCCAACCCTCGGCGCTGGCACTCCTGCCCAGCAGGCCGAGTCACAAAAAACAGTTATTCGC
TCTGGTGGTGGTCAGACATGGACCGACTCGACCCTATTGGAGTGGGACCCGGCACATTTCCGACTTTTTGTGGGT
AACCTCGCAGGTGAAGTGACGGATGAGTCTCTACTGAAGGCATTCGCCTCCTACACATCGGTCCAGAAAGCTCGT
GTCGTCCGAGAGAAACGAACCCAGAAGAGCTTAGGCTATGGGTTCGTCAGTTTCAGTGGAAGTGACGACTACTTC
AAAGCGGCACGAGAAATGCATGGCAAGTACATTGGTTCGCACCCAATCCTACTGCGCCGAGCGGTAACCGAGGTT
CGCCCAACTTCGGCCCCCAAGCATGGAAAGCATGGAAAGAAACAAGGCAAGGGCAAGGGTCCTAAGGGAGACAAC
GCCGGTGGCGCAGGTGGAAAAGTGAAGCAGGACGGTATCAAAAAGCCAGCCAAAACGAAGGGAGGATTGAAGATT
CTGGGTTAA
Gene >Pro_DTO377G3_2|g5670.t1
ATGTCCCTTCCGCCTCCTCCAGGTCTCAAACAGACTCCCTCGTCACTTCCGCCCCGCCCACCTCCATCCTCCAAT
GCCGCGCAGCCTCCCACCGCCAATCCTGCAGGCTATGGCGGTAGACCTCGACCAACGGGCTACAACGCCTTCACG
GCGTTCCAGCCGCGCGCGGTAGCCTCCAGTCAACCGCGTCGCCCCAACAACTACTCGGTCGCGAATCCGCCAGTC
TCTGCTGGATACGCAACCCCCGTCAAGAGCTACGTCAATCAATATCAACAACCTCAGACATACCAAAGTGGGCCT
TCCTACTATGGACAACCTCAATACGCTGAAAACACATACGGCCCGACCGTCCCACATATTACGAACCCGTTCGGA
TCTACGCCCAATACAGGGTTTTCACAGGGTGGCAACGCCCCCGGATTTGACGCAGAGACGGAAGCTCAAATCGCG
CAGTGGCAGAGCGCCTACAATAGGCCCACCGATGACCCCAAGAATCAAGGCAACCAGCCGGGTTCAGGCGTGAAC
ACGGGAGCTGGAACCCCAACCCTCGGCGCTGGCACTCCTGCCCAGCAGGCCGAGTCACAAAAAACAGTTATTCGC
TCTGGTGGTGGTCAGACATGGACCGACTCGACCCTATTGGAGTGGGACCCGGCACATTTCCGACTTTTTGTGGGT
AACCTCGCAGGTGAAGTGACGGATGAGTCTCTACTGAAGGCATTCGCCTCCTACACATCGGTCCAGAAAGCTCGT
GTCGTCCGAGAGAAACGAACCCAGAAGAGCTTAGGCTATGGGTTCGTCAGTTTCAGTGGAAGTGACGACTACTTC
AAAGCGGCACGAGAAATGCATGGCAAGTACATTGGTTCGCACCCAATCCTACTGCGCCGAGCGGTAACCGAGGTT
CGCCCAACTTCGGCCCCCAAGCATGGAAAGCATGGAAAGAAACAAGGCAAGGGCAAGGGTCCTAAGGGAGACAAC
GCCGGTGGCGCAGGTGGAAAAGTGAAGCAGGACGGTATCAAAAAGCCAGCCAAAACGAAGGGAGGATTGAAGATT
CTGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail