Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5669.t1
Gene name
Locationscaffold_14:83039..88666
Strand+
Gene length (bp)5627
Transcript length (bp)4428
Coding sequence length (bp)4428
Protein length (aa) 1476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06333 Med13_C Mediator complex subunit 13 C-terminal domain 1.1E-74 1153 1438
PF11597 Med13_N Mediator complex subunit 13 N-terminal 1.7E-69 1 369
PF18296 MID_MedPIWI MID domain of medPIWI 3.5E-11 977 1055
PF18296 MID_MedPIWI MID domain of medPIWI 7.1E-20 1057 1142

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0080090 regulation of primary metabolic process No
GO:0044446 intracellular organelle part No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0044464 cell part No
GO:0140110 transcription regulator activity No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0031323 regulation of cellular metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044428 nuclear part No
GO:2001141 regulation of RNA biosynthetic process No
GO:0044451 nucleoplasm part No
GO:0044422 organelle part No
GO:0044424 intracellular part No
GO:0019222 regulation of metabolic process No
GO:0010468 regulation of gene expression No
GO:0010556 regulation of macromolecule biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5669.t1
MDFPGGANTNIHLIDGFSNIYWRIYTEEAGITNNPQESPANGYTILKHLSRLKDLEARLRGLNCLASCPRRLGLW
VFSPTPEFESLKPLYVRGSDTESNKIVVGTTTLKVSALGSVSSLDLVKGLSSDNQSQNGTQPAAQPRPHQSQPTS
RRQDGYSSSAAIYASFVSAVTGSISLQLIRRHGALPLGSRTLFTAIEKSGYESPHINNESILSTSCLTTLNVQLT
ISGTITVSAQTVSQTGITRLCSPRDDISKITDVQPGIDLWLCPSGTIARLVTANIDSPTVPSLGHPTPGNLSAKR
IQWKLDVVQWLRNFGLHVDSIDEEPWVEVEVWEPFFARLAGEAWRQSDDSQSALPLKRMLWPARFCFRRASSSNF
SSDAQTSLLDEPLDFAEQWSTMASSLKLDHISHIAQNTPTTQDSRPKDQEMASPPKAEPLETTESLSRIAQYPDL
QTMNLVYPTPPDGAAAVGLNNPNPPEAFADDSDFGLPHATQRNSRRNVPGSDISPVQNSGVGIGTGRYDASDEED
LFGEMNERDFGSKGITDADFSFFDDPDFDGMEGDSRVEDADEAVEAPRPQSESEAEAMVDAELSPNQSREIPTHL
ETHEVHASPIHHESPQLSERPMAPEESAHSPMDRAGQTISPPLSPVEVKKILFPGSEADDRRQPTGHRGQGHYHP
VAFEKKLGDWDRKYGAAGKFWFSGGNSLDTLNQTSAIPTIGIPRRDRSNANVPSSKERNKTSLSLIQSENGLRSA
SVSSDSSDDSIEIMSEHVPTPAAMPSIPSLKRKRAPSESDIMSVASQEKSFPGTEANPAYAAENSTFLGNFLANF
SDWTLTGYFSAFPPQQLPVLPRHEGQLEIAQLLVDQITQSSLKHPLDGKIGLFDLESESLSLQALDDTALLGETS
RMDFKKYTSFQDEFVANLPQQQPPQHQALPKDPPKSFISKLSAPHIRVRRGKEYLEALPPAVSFWETFGLEPAHG
PKNISAYCIHPPAASTAADVFLRRFGLLYQSCSLGTHTRGDDSVAFEEGLKLWKSETSSYESMMQVLKRTCEQLG
SELSQSTATADNHVVYIINPFTHAAALADICSAFWYLFQQLVAGSERRQTRIANELVLQIIPLEFVMSSETMVIP
PQVDYLNLALEVYSRCRSNDAEMSPLLCAPPMLLADAIPRAISFRLAPERSSPLQDGRSLHIAYSKSLDQRWISV
AWSDLPGSIQRTMSYCLRYRQSGGTRPVSEVRNEIWATTKHIMEKFQARWKVQLATTEPMETEEVEAWASLADQH
NKSKPGSLELTILAVNTVPDLILEPPVPPVSMAMLNILSSSTPVSTPNPNASVASPEQSGNAATPTSAGPAAYSA
PTPTDMSLETDSETVLTDICDDSWLAILSHRLNSSPHLTEFRPALSSGYLLRRKGTTDADGVFATSVNLIYSPRI
PVSHDSVLKDTLKGDVALYSPDGESSDCEEEEEDDDDNRDGDVALDHLGW*
Coding >Pro_DTO377G3_2|g5669.t1
ATGGACTTCCCTGGCGGCGCAAACACCAACATACATCTTATTGATGGATTCTCCAACATCTACTGGAGAATATAC
ACAGAAGAAGCTGGTATCACAAATAACCCACAAGAGAGCCCCGCCAATGGCTACACTATTCTCAAGCACTTGAGT
CGTCTCAAAGATTTAGAGGCTCGATTGAGGGGTTTGAACTGCCTGGCCTCATGTCCAAGGCGCCTGGGGCTTTGG
GTGTTTTCCCCCACTCCCGAGTTTGAGAGCCTCAAACCTTTGTATGTGAGGGGAAGTGACACAGAGTCAAATAAG
ATCGTCGTTGGTACCACAACTTTGAAAGTCTCTGCATTGGGAAGTGTCTCCTCGCTGGACTTAGTGAAGGGGCTG
TCGTCCGACAATCAGAGTCAGAACGGTACCCAACCCGCGGCACAGCCACGGCCACATCAGAGCCAGCCTACCTCT
CGACGACAAGATGGTTACAGCAGTTCAGCGGCCATTTATGCCTCCTTTGTATCTGCTGTCACCGGTTCAATTAGC
CTCCAGTTGATTAGACGCCATGGTGCTCTGCCCCTCGGATCACGAACCCTTTTCACTGCCATCGAAAAGTCAGGA
TACGAAAGCCCCCATATCAACAATGAGAGCATCCTCTCCACTTCTTGCTTGACTACACTCAATGTTCAGTTAACT
ATAAGTGGAACAATAACTGTCTCCGCCCAGACTGTATCCCAAACGGGCATAACTCGACTGTGCAGTCCACGCGAC
GACATTTCTAAAATAACCGACGTTCAGCCTGGAATTGATCTTTGGCTATGCCCGAGCGGGACTATCGCTAGACTT
GTCACGGCTAATATTGACTCGCCAACCGTTCCCTCTCTGGGCCACCCCACCCCTGGGAATCTGTCTGCGAAAAGA
ATACAGTGGAAATTGGATGTTGTGCAGTGGCTGCGGAATTTTGGGTTACATGTTGACTCAATTGATGAAGAACCC
TGGGTTGAAGTGGAGGTTTGGGAGCCATTTTTCGCGAGGCTTGCTGGGGAAGCATGGCGACAGAGTGATGATAGT
CAATCTGCACTGCCACTGAAACGCATGCTGTGGCCAGCGAGATTTTGCTTCAGAAGGGCTAGCTCATCAAATTTC
TCTTCCGATGCTCAAACTTCCCTTCTTGACGAACCTCTAGATTTTGCAGAGCAATGGTCTACAATGGCGAGCTCT
CTCAAGCTAGATCATATTTCCCATATTGCTCAAAACACCCCTACCACCCAAGACTCACGACCAAAAGACCAAGAA
ATGGCATCACCACCCAAGGCCGAACCCTTGGAAACCACAGAGAGTTTATCCCGAATTGCGCAATATCCTGATTTG
CAAACCATGAATCTTGTCTATCCAACGCCCCCAGACGGAGCTGCAGCAGTCGGGTTGAACAATCCAAACCCTCCT
GAGGCTTTTGCCGACGATTCTGACTTCGGGCTACCACATGCAACGCAACGAAATTCAAGAAGAAATGTGCCAGGA
TCTGATATATCACCCGTTCAAAATAGTGGCGTTGGAATTGGCACTGGCCGATATGATGCAAGCGACGAAGAAGAT
CTCTTTGGGGAAATGAACGAAAGAGATTTTGGGTCGAAAGGTATCACCGATGCGGACTTCAGCTTTTTCGATGAC
CCTGATTTCGATGGCATGGAGGGTGACTCTCGGGTAGAGGATGCAGATGAAGCAGTTGAAGCACCCCGTCCTCAA
AGCGAATCGGAGGCCGAGGCCATGGTTGATGCAGAGCTCTCCCCCAATCAGTCACGGGAAATCCCAACTCATTTG
GAAACCCATGAGGTACACGCCTCTCCGATACACCACGAATCACCACAGTTATCTGAACGGCCCATGGCCCCCGAA
GAATCAGCTCATTCGCCTATGGATCGCGCAGGTCAAACAATCAGCCCGCCCTTGAGCCCAGTAGAAGTGAAGAAG
ATATTGTTCCCGGGGTCTGAGGCAGACGATCGTCGACAGCCTACAGGTCACCGGGGGCAAGGGCATTACCACCCA
GTGGCATTCGAAAAGAAACTTGGTGATTGGGATCGGAAGTACGGAGCAGCTGGCAAATTCTGGTTCTCCGGTGGT
AACTCGTTGGACACATTAAATCAGACATCTGCCATACCCACGATTGGCATTCCTCGCCGTGACCGAAGCAACGCC
AACGTACCTAGCTCAAAAGAACGTAACAAGACCAGTCTATCTCTGATTCAGTCAGAAAATGGTCTACGATCAGCC
TCGGTGAGCAGTGACAGCAGCGACGATAGTATCGAGATCATGTCGGAGCATGTTCCAACGCCGGCAGCCATGCCC
TCGATCCCCTCTTTGAAGCGGAAACGAGCTCCTTCAGAATCCGATATAATGTCAGTTGCATCCCAAGAGAAGTCA
TTTCCTGGCACAGAAGCAAATCCTGCGTACGCAGCCGAGAACTCTACGTTCCTCGGCAATTTTCTAGCTAATTTT
TCCGATTGGACCCTCACCGGTTATTTCTCTGCTTTCCCACCTCAACAACTCCCTGTTCTTCCTCGCCATGAAGGT
CAACTTGAAATTGCCCAACTTCTGGTTGACCAAATTACGCAGTCCTCCCTCAAGCATCCACTTGATGGGAAAATT
GGTCTTTTTGATCTCGAGAGCGAGTCTTTGTCACTGCAAGCCCTCGACGACACAGCACTCTTGGGCGAGACCTCG
AGAATGGACTTCAAAAAATATACGTCATTTCAGGATGAATTTGTCGCGAATCTTCCACAGCAGCAACCGCCACAA
CATCAGGCGCTGCCCAAAGACCCCCCAAAAAGCTTCATTTCAAAGTTATCGGCGCCTCATATACGTGTGCGTCGA
GGTAAAGAATACTTAGAGGCGCTTCCCCCGGCTGTATCCTTTTGGGAGACATTCGGTCTTGAGCCTGCTCATGGG
CCAAAGAACATTTCTGCTTATTGTATTCACCCACCAGCTGCGTCAACGGCAGCGGATGTTTTCTTGAGGCGGTTT
GGTCTGCTCTACCAAAGTTGCAGTCTTGGAACTCATACCAGAGGAGACGATTCTGTAGCATTCGAAGAGGGGCTG
AAGCTATGGAAATCTGAAACATCTAGCTATGAATCTATGATGCAGGTATTGAAGAGAACATGCGAGCAGCTTGGC
TCAGAGCTCTCACAGTCTACGGCAACTGCTGATAACCATGTTGTCTATATTATCAACCCATTTACGCACGCTGCA
GCATTGGCTGACATTTGTTCCGCCTTCTGGTACCTTTTCCAACAATTGGTAGCCGGTTCCGAACGACGACAGACT
CGAATTGCCAACGAGCTTGTTCTGCAGATAATTCCCCTAGAGTTCGTGATGTCAAGCGAAACGATGGTTATACCT
CCCCAGGTGGATTATTTGAATTTGGCCTTAGAAGTCTACAGTCGATGTCGCTCCAATGATGCGGAGATGAGCCCC
CTGCTCTGTGCGCCACCAATGCTTTTGGCCGACGCCATTCCGAGAGCCATAAGTTTCCGACTTGCTCCTGAAAGA
TCCTCGCCGCTTCAAGATGGCCGAAGTCTTCACATTGCCTACTCCAAAAGTCTTGATCAACGCTGGATATCGGTG
GCATGGTCCGATTTGCCAGGCTCTATTCAAAGAACCATGTCTTACTGTCTGCGGTATCGTCAGTCGGGTGGTACC
AGACCTGTTTCCGAAGTAAGGAATGAGATTTGGGCTACGACGAAACACATTATGGAGAAATTCCAAGCACGATGG
AAAGTTCAGCTAGCGACTACCGAGCCCATGGAAACCGAGGAGGTTGAAGCCTGGGCTAGTCTAGCAGACCAGCAC
AACAAGTCAAAGCCTGGGTCATTGGAATTGACCATTCTGGCTGTCAACACTGTTCCTGACTTGATCCTTGAGCCA
CCGGTTCCACCCGTATCGATGGCGATGCTGAATATACTGTCTTCGTCTACCCCCGTGTCGACTCCTAATCCAAAT
GCCAGCGTTGCTTCCCCCGAACAATCAGGCAATGCAGCCACGCCAACCAGCGCCGGTCCCGCCGCCTATAGTGCC
CCCACGCCAACGGATATGTCACTCGAAACCGATTCAGAAACTGTTCTCACTGATATCTGCGACGATTCCTGGCTA
GCCATCCTATCCCACCGACTCAACAGCTCTCCACACCTCACCGAATTCCGACCCGCCCTATCCAGCGGGTATCTC
CTTCGCCGCAAGGGCACTACTGATGCGGACGGTGTATTTGCTACCTCCGTTAATCTCATTTATTCCCCACGTATT
CCCGTATCTCACGACAGCGTCCTGAAAGATACCTTAAAAGGAGACGTGGCTTTGTACAGCCCAGATGGCGAATCC
AGCGATTGCGAGGAGGAGGAAGAGGATGATGATGATAATCGCGATGGTGATGTTGCGCTGGACCATCTTGGGTGG
TAG
Transcript >Pro_DTO377G3_2|g5669.t1
ATGGACTTCCCTGGCGGCGCAAACACCAACATACATCTTATTGATGGATTCTCCAACATCTACTGGAGAATATAC
ACAGAAGAAGCTGGTATCACAAATAACCCACAAGAGAGCCCCGCCAATGGCTACACTATTCTCAAGCACTTGAGT
CGTCTCAAAGATTTAGAGGCTCGATTGAGGGGTTTGAACTGCCTGGCCTCATGTCCAAGGCGCCTGGGGCTTTGG
GTGTTTTCCCCCACTCCCGAGTTTGAGAGCCTCAAACCTTTGTATGTGAGGGGAAGTGACACAGAGTCAAATAAG
ATCGTCGTTGGTACCACAACTTTGAAAGTCTCTGCATTGGGAAGTGTCTCCTCGCTGGACTTAGTGAAGGGGCTG
TCGTCCGACAATCAGAGTCAGAACGGTACCCAACCCGCGGCACAGCCACGGCCACATCAGAGCCAGCCTACCTCT
CGACGACAAGATGGTTACAGCAGTTCAGCGGCCATTTATGCCTCCTTTGTATCTGCTGTCACCGGTTCAATTAGC
CTCCAGTTGATTAGACGCCATGGTGCTCTGCCCCTCGGATCACGAACCCTTTTCACTGCCATCGAAAAGTCAGGA
TACGAAAGCCCCCATATCAACAATGAGAGCATCCTCTCCACTTCTTGCTTGACTACACTCAATGTTCAGTTAACT
ATAAGTGGAACAATAACTGTCTCCGCCCAGACTGTATCCCAAACGGGCATAACTCGACTGTGCAGTCCACGCGAC
GACATTTCTAAAATAACCGACGTTCAGCCTGGAATTGATCTTTGGCTATGCCCGAGCGGGACTATCGCTAGACTT
GTCACGGCTAATATTGACTCGCCAACCGTTCCCTCTCTGGGCCACCCCACCCCTGGGAATCTGTCTGCGAAAAGA
ATACAGTGGAAATTGGATGTTGTGCAGTGGCTGCGGAATTTTGGGTTACATGTTGACTCAATTGATGAAGAACCC
TGGGTTGAAGTGGAGGTTTGGGAGCCATTTTTCGCGAGGCTTGCTGGGGAAGCATGGCGACAGAGTGATGATAGT
CAATCTGCACTGCCACTGAAACGCATGCTGTGGCCAGCGAGATTTTGCTTCAGAAGGGCTAGCTCATCAAATTTC
TCTTCCGATGCTCAAACTTCCCTTCTTGACGAACCTCTAGATTTTGCAGAGCAATGGTCTACAATGGCGAGCTCT
CTCAAGCTAGATCATATTTCCCATATTGCTCAAAACACCCCTACCACCCAAGACTCACGACCAAAAGACCAAGAA
ATGGCATCACCACCCAAGGCCGAACCCTTGGAAACCACAGAGAGTTTATCCCGAATTGCGCAATATCCTGATTTG
CAAACCATGAATCTTGTCTATCCAACGCCCCCAGACGGAGCTGCAGCAGTCGGGTTGAACAATCCAAACCCTCCT
GAGGCTTTTGCCGACGATTCTGACTTCGGGCTACCACATGCAACGCAACGAAATTCAAGAAGAAATGTGCCAGGA
TCTGATATATCACCCGTTCAAAATAGTGGCGTTGGAATTGGCACTGGCCGATATGATGCAAGCGACGAAGAAGAT
CTCTTTGGGGAAATGAACGAAAGAGATTTTGGGTCGAAAGGTATCACCGATGCGGACTTCAGCTTTTTCGATGAC
CCTGATTTCGATGGCATGGAGGGTGACTCTCGGGTAGAGGATGCAGATGAAGCAGTTGAAGCACCCCGTCCTCAA
AGCGAATCGGAGGCCGAGGCCATGGTTGATGCAGAGCTCTCCCCCAATCAGTCACGGGAAATCCCAACTCATTTG
GAAACCCATGAGGTACACGCCTCTCCGATACACCACGAATCACCACAGTTATCTGAACGGCCCATGGCCCCCGAA
GAATCAGCTCATTCGCCTATGGATCGCGCAGGTCAAACAATCAGCCCGCCCTTGAGCCCAGTAGAAGTGAAGAAG
ATATTGTTCCCGGGGTCTGAGGCAGACGATCGTCGACAGCCTACAGGTCACCGGGGGCAAGGGCATTACCACCCA
GTGGCATTCGAAAAGAAACTTGGTGATTGGGATCGGAAGTACGGAGCAGCTGGCAAATTCTGGTTCTCCGGTGGT
AACTCGTTGGACACATTAAATCAGACATCTGCCATACCCACGATTGGCATTCCTCGCCGTGACCGAAGCAACGCC
AACGTACCTAGCTCAAAAGAACGTAACAAGACCAGTCTATCTCTGATTCAGTCAGAAAATGGTCTACGATCAGCC
TCGGTGAGCAGTGACAGCAGCGACGATAGTATCGAGATCATGTCGGAGCATGTTCCAACGCCGGCAGCCATGCCC
TCGATCCCCTCTTTGAAGCGGAAACGAGCTCCTTCAGAATCCGATATAATGTCAGTTGCATCCCAAGAGAAGTCA
TTTCCTGGCACAGAAGCAAATCCTGCGTACGCAGCCGAGAACTCTACGTTCCTCGGCAATTTTCTAGCTAATTTT
TCCGATTGGACCCTCACCGGTTATTTCTCTGCTTTCCCACCTCAACAACTCCCTGTTCTTCCTCGCCATGAAGGT
CAACTTGAAATTGCCCAACTTCTGGTTGACCAAATTACGCAGTCCTCCCTCAAGCATCCACTTGATGGGAAAATT
GGTCTTTTTGATCTCGAGAGCGAGTCTTTGTCACTGCAAGCCCTCGACGACACAGCACTCTTGGGCGAGACCTCG
AGAATGGACTTCAAAAAATATACGTCATTTCAGGATGAATTTGTCGCGAATCTTCCACAGCAGCAACCGCCACAA
CATCAGGCGCTGCCCAAAGACCCCCCAAAAAGCTTCATTTCAAAGTTATCGGCGCCTCATATACGTGTGCGTCGA
GGTAAAGAATACTTAGAGGCGCTTCCCCCGGCTGTATCCTTTTGGGAGACATTCGGTCTTGAGCCTGCTCATGGG
CCAAAGAACATTTCTGCTTATTGTATTCACCCACCAGCTGCGTCAACGGCAGCGGATGTTTTCTTGAGGCGGTTT
GGTCTGCTCTACCAAAGTTGCAGTCTTGGAACTCATACCAGAGGAGACGATTCTGTAGCATTCGAAGAGGGGCTG
AAGCTATGGAAATCTGAAACATCTAGCTATGAATCTATGATGCAGGTATTGAAGAGAACATGCGAGCAGCTTGGC
TCAGAGCTCTCACAGTCTACGGCAACTGCTGATAACCATGTTGTCTATATTATCAACCCATTTACGCACGCTGCA
GCATTGGCTGACATTTGTTCCGCCTTCTGGTACCTTTTCCAACAATTGGTAGCCGGTTCCGAACGACGACAGACT
CGAATTGCCAACGAGCTTGTTCTGCAGATAATTCCCCTAGAGTTCGTGATGTCAAGCGAAACGATGGTTATACCT
CCCCAGGTGGATTATTTGAATTTGGCCTTAGAAGTCTACAGTCGATGTCGCTCCAATGATGCGGAGATGAGCCCC
CTGCTCTGTGCGCCACCAATGCTTTTGGCCGACGCCATTCCGAGAGCCATAAGTTTCCGACTTGCTCCTGAAAGA
TCCTCGCCGCTTCAAGATGGCCGAAGTCTTCACATTGCCTACTCCAAAAGTCTTGATCAACGCTGGATATCGGTG
GCATGGTCCGATTTGCCAGGCTCTATTCAAAGAACCATGTCTTACTGTCTGCGGTATCGTCAGTCGGGTGGTACC
AGACCTGTTTCCGAAGTAAGGAATGAGATTTGGGCTACGACGAAACACATTATGGAGAAATTCCAAGCACGATGG
AAAGTTCAGCTAGCGACTACCGAGCCCATGGAAACCGAGGAGGTTGAAGCCTGGGCTAGTCTAGCAGACCAGCAC
AACAAGTCAAAGCCTGGGTCATTGGAATTGACCATTCTGGCTGTCAACACTGTTCCTGACTTGATCCTTGAGCCA
CCGGTTCCACCCGTATCGATGGCGATGCTGAATATACTGTCTTCGTCTACCCCCGTGTCGACTCCTAATCCAAAT
GCCAGCGTTGCTTCCCCCGAACAATCAGGCAATGCAGCCACGCCAACCAGCGCCGGTCCCGCCGCCTATAGTGCC
CCCACGCCAACGGATATGTCACTCGAAACCGATTCAGAAACTGTTCTCACTGATATCTGCGACGATTCCTGGCTA
GCCATCCTATCCCACCGACTCAACAGCTCTCCACACCTCACCGAATTCCGACCCGCCCTATCCAGCGGGTATCTC
CTTCGCCGCAAGGGCACTACTGATGCGGACGGTGTATTTGCTACCTCCGTTAATCTCATTTATTCCCCACGTATT
CCCGTATCTCACGACAGCGTCCTGAAAGATACCTTAAAAGGAGACGTGGCTTTGTACAGCCCAGATGGCGAATCC
AGCGATTGCGAGGAGGAGGAAGAGGATGATGATGATAATCGCGATGGTGATGTTGCGCTGGACCATCTTGGGTGG
TAG
Gene >Pro_DTO377G3_2|g5669.t1
ATGGACTTCCCTGGCGGCGCAAACACCAACATACATCTTATTGTGAGTATCGTAATATTTACAGTACATTCGCGT
CCATGCTGACGCGTCACATCAGGATGGATTCTCCAACATCTACTGGAGAATATACACAGAAGAAGCTGGTATCAC
AAATAACCCACAAGAGAGCCCCGCCAATGGCTACACTATTCTCAAGCACTTGAGTCGTCTCAAAGATTTAGAGGC
TCGATTGAGGGGTTTGAACTGCCTGGCCTCATGTCCAAGGCGCCTGGGGCTTTGGGTGTTTTCCCCCACTCCCGA
GTTTGAGAGCCTCAAACCTTTGTATGTGAGGGGAAGTGACACAGAGTCAAATAAGATCGTCGTTGGTACCACAAC
TTTGAAAGGTAAGTCTCTGGCCAGCTCGTAGACTTATTCGGGGCCTTGTTAATTTTATTACAATAGTCTCTGCAT
TGGGAAGTGTCTCCTCGCTGGACTTAGTGAAGGGGCTGTCGTCCGACAATCAGAGTCAGAACGGTACCCAACCCG
CGGCACAGCCACGGCCACATCAGAGCCAGCCTACCTCTCGACGACAAGATGGTTACAGCAGTTCAGCGGCCATTT
ATGCCTCCTTTGTATCTGCTGTCACCGGTTCAATTAGCCTCCAGTTGATTAGACGCCATGGTGCTCTGCCCCTCG
GATCACGAACCCTTTTCACTGCCATCGAAAAGTCAGGATACGAAAGCCCCCATATCAACAATGAGAGCATCCTCT
CCACTTCTTGCTTGACTACACTCAATGTTCAGTTAACTATAAGTGGAACAATAACTGTCTCCGCCCAGACTGTAT
CCCAAACGGGCATAACTCGACTGTGCAGTCCACGCGACGACATTTCTAAAATAACCGACGTTCAGCCTGGAATTG
ATCTTTGGCTATGCCCGAGCGGGACTATCGCTAGACTTGTCACGGCTAATATTGACTCGCCAACCGTTCCCTCTC
TGGGCCACCCCACCCCTGGGAATCTGTCTGCGAAAAGAATACAGTGGAAATTGGATGTTGTGCAGTGGCTGCGGA
ATTTTGGGTTACATGTTGACTCAATTGATGAAGAACCCTGGGTTGAAGTGGAGGTTTGGGAGCCATTTTTCGCGA
GGCTTGCTGGGGAAGCATGGCGACAGAGTGATGATAGTCAATCTGCACTGCCACTGAAACGCATGCTGTGGCCAG
CGAGATTTTGCTTCAGAAGGGCTAGCTCATCAAATTTCTCTTCCGATGCTCAAACTTCCCTTCTTGACGAACCTC
TAGATTTTGCAGAGCAATGGTCTACAATGGCGAGCTCTCTCAAGCTAGATCATATTTCCCATATTGCTCAAAACA
CCCCTACCACCCAAGACTCACGACCAAAAGACCAAGAAATGGCATCACCACCCAAGGCCGAACCCTTGGAAACCA
CAGAGAGTTTATCCCGAATTGCGCAATATCCTGATTTGCAAACCATGAATCTTGTCTATCCAACGCCCCCAGACG
GAGCTGCAGCAGTCGGGTTGAACAATCCAAACCCTCCTGAGGCTTTTGCCGACGATTCTGACTTCGGGCTACCAC
ATGCAACGCAACGAAATTCAAGAAGAAATGTGCCAGGATCTGATATATCACCCGTTCAAAATAGTGGCGTTGGAA
TTGGCACTGGCCGATATGATGCAAGCGACGAAGAAGATCTCTTTGGGGAAATGAACGAAAGAGATTTTGGGTCGA
AAGGTATCACCGATGCGGACTTCAGCTTTTTCGATGACCCTGATTTCGATGGCATGGAGGGTGACTCTCGGGTAG
AGGATGCAGATGAAGCAGTTGAAGCACCCCGTCCTCAAAGCGAATCGGAGGCCGAGGCCATGGTTGATGCAGAGC
TCTCCCCCAATCAGTCACGGGAAATCCCAACTCATTTGGAAACCCATGAGGTACACGCCTCTCCGATACACCACG
AATCACCACAGTTATCTGAACGGCCCATGGCCCCCGAAGAATCAGCTCATTCGCCTATGGATCGCGCAGGTCAAA
CAATCAGCCCGCCCTTGAGCCCAGTAGAAGTGAAGAAGATATTGTTCCCGGGGTCTGAGGCAGACGATCGTCGAC
AGCCTACAGGTCACCGGGGGCAAGGGCATTACCACCCAGTGGCATTCGAAAAGAAACTTGGTGATTGGGATCGGA
AGTACGGAGCAGCTGGCAAATTCTGGTTCTCCGGTGGTAACTCGTTGGACACATTAAATCAGACATCTGCCATAC
CCACGATTGGCATTCCTCGCCGTGACCGAAGCAACGCCAACGTACCTAGCTCAAAAGAACGTAACAAGACCAGTC
TATCTCTGATTCAGTCAGAAAATGGTCTACGATCAGCCTCGGTGAGCAGTGACAGCAGCGACGATAGTATCGAGA
TCATGTCGGAGCATGTTCCAACGCCGGCAGCCATGCCCTCGATCCCCTCTTTGAAGCGGAAACGAGCTCCTTCAG
AATCCGATATAATGTCAGTTGCATCCCAAGAGAAGTCATTTCCTGGCACAGAAGCAAATCCTGCGTACGCAGCCG
AGAACTCTACGTTCCTCGGCAATTTTCTAGCTAATTTTTCCGATTGGACCCTCACCGGTTATTTCTCTGCTTTCC
CACCTCAACAACTCCCTGTTCTTCCTCGCCATGAAGGTCAACTTGAAATTGCCCAACTTCTGGTTGACCAAATTA
CGCAGTCCTCCCTCAAGCATCCACTTGATGGGAAAATTGGTCTTTTTGATCTCGAGAGCGAGTCTTTGTCACTGC
AAGCCCTCGACGACACAGCACTCTTGGGCGAGACCTCGAGAATGGACTTCAAAAAATATACGTCATTTCAGGATG
AATTTGTCGCGAATCTTCCACAGCAGCAACCGCCACAACATCAGGCGCTGCCCAAAGACCCCCCAAAAAGCTTCA
TTTCAAAGTTATCGGCGCCTCATATACGTGTGCGTCGAGGTAAAGAATACTTAGAGGCGCTTCCCCCGGCTGTAT
CCTTTTGGGAGACATTCGGTCTTGAGCCTGCTCATGGGCCAAAGAACATTTCTGCTTATTGTATTCACCCACCAG
CTGCGTCAACGGCAGCGGATGTTTTCTTGAGGCGGTTTGGTCTGCTCTACCAAAGTTGCAGTCTTGGAACTCATA
CCAGAGGAGACGATTCTGTAGCATTCGAAGAGGGGCTGAAGCTATGGAAATCTGAAACATCTAGCTATGAATCTA
TGATGCAGGTATTGAAGAGAACATGCGAGCAGCTTGGTATGTGTTTTCTCTGATGATTATGTGCTTTACTAACAA
TTCCCAAGGCTCAGAGCTCTCACAGTCTACGGCAACTGCTGATAACCATGTTGTCTATATTATCAACCCATTTAC
GCACGCTGCAGCATTGGCTGACATTTGTTCCGCCTTCTGGTACCTTTTCCAACAATTGGTAGCCGGTTCCGAACG
ACGACAGACTCGAATTGCCAACGAGCTTGTTCTGCAGATAATTCCCCTAGAGTTCGTGATGTCAAGCGAAACGAT
GGTTATACCTCCCCAGGTGGATTATTTGAATTTGGCCTTAGAAGTCTACAGTCGATGTCGCTCCAATGATGCGGA
GATGAGCCCCCTGCTCTGTGCGCCACCAATGCTTTTGGCCGACGCCATTCCGAGAGCCATAAGTTTCCGACTTGC
TCCTGAAAGATCCTCGCCGCTTCAAGATGGCCGAAGTCTTCACATTGCCTACTCCAAAAGTCTTGATCAACGCTG
GATATCGGTGGCATGGTCCGATTTGCCAGGCTCTATTCAAAGAACCATGTCTTACTGTCTGCGGTATCGTCAGTC
GGGTGGTACCAGACCTGTTTCCGAAGTAAGGAATGAGATTTGGGCTACGACGAAACACATTATGGAGAAATTCCA
AGCACGATGGAAAGTTCAGCTAGCGACTACCGAGCCCATGGAAACCGAGGAGGTTGAAGGTACTGCTTCGTATTT
TTTTTTTTGATATCGAGGACATATCGCTAACACATTCACAGCCTGGGCTAGTCTAGCAGACCAGCACAACAAGTC
AAAGCCTGGGTCATTGGAATTGACCATTCTGGCTGTCAACACTGTTCCTGACTTGATCCTTGAGCCACCGGTTCC
ACCCGTATCGATGGCGATGCTGAATATACTGTCTTCGTCTACCCCCGTGTCGACTCCTAATCCAAATGCCAGCGT
TGCTTCCCCCGAACAATCAGGCAATGCAGCCACGCCAACCAGCGCCGGTCCCGCCGCCTATAGTGCCCCCACGCC
AACGGATATGTCACTCGAAACCGATTCAGAAACTGTTCTCACTGATATCTGCGACGATTCCTGGCTAGCCATCCT
ATCCCACCGACTCAACAGCTCTCCACACCTCACCGAATTCCGACCCGCCCTATCCAGCGGGTATCTCCTTCGCCG
CAAGGGCACTACTGATGCGGACGGTGTATTTGCTACCTCCGTTAATCTCATTTATTCCCCACGTATTCCCGTATC
TCACGACAGCGTCCTGAAAGATACCTTAAGTATGTACCGGGACCTGGGCTGTCTTGCCCGGGCCAAGGGCATATG
CAGTGTACAAAACAACACACTGCCTTGGCATGTTGCCACAGCTCTTCGCGCACAAGAGCTTTTGAGTTATGTTTT
TTGAGCGAGATGATATCTTATTACTGGGGCGTTATGGTTGCTCTATCTACTTGGGATTTCATGTATGTTACAGCT
TTTTCGGTGATGGGATGTTTTATTACCTAGTTTGGGTAGATATGTATACCCTGGGAGGCAGTGCATTTGAATTCC
CCTTGTTTATTGTACATGGTTGTCTAAGTATCGAGAAGTCGGAATCATACTTCTTAAAATATCGATGGACATATC
TTTACATCTACGATCTGTATCCTTGGGACACTACCTAGGCATTCCCTTCTTATATGGCTTCGAAAAGATGTGAGA
TAGATCGATGTTGTTCCGAAATTTTGTCAAATTGGGATATTTTCAAACTGTCAATGGAAATATGCACCATGGGTT
TCAACAAAGCGAAGAATATGCATCAATGCAGTCCTCGTCAAATACATCCAAGAAAAGAAAAGGACTCAGCAAAAG
ACCTCTAACTCCACACTAAAAAACCAAAAAAAGAAAAAGAAGAAAATACACCGAAAGCAACGTATGTACTGATTG
CTTCCAATCGCTAACAATTGTACAAAAAAAGGCGTGTTCCAACGTGAAAGACTCGTAACGCAGCTCGTCATCGTG
GGTGGTAGTATTGAATGCCAACAGAAAGGGTATCGTATCGCAGATAAGGTCGTAGTCGTAGATGTGTGTGTGATC
GTGATGGTATGTATATGTGCGTATTCCGAAAAAGAAAAGAGGCAATTAATGCCTGTAAAAGCGAGACCAAGAGAG
GCCCGAGGCCGAGCGTCAAGGGTGTATATGTTGTAGTGCTTGCTGCTGCATGCTACCCTGCTTTATCACCCATCC
GCACTCTCTGCATCGGTCTCCTTCTTCCTGGAGAAGAAGGAGACGTGGCTTTGTACAGCCCAGATGGCGAATCCA
GCGATTGCGAGGAGGAGGAAGAGGATGATGATGATAATCGCGATGGTGATGTTGCGCTGGACCATCTTGGGTGGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail