Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5655.t1
Gene name
Locationscaffold_14:46724..48826
Strand-
Gene length (bp)2102
Transcript length (bp)1905
Coding sequence length (bp)1905
Protein length (aa) 635

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 2.4E-33 282 477
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 5.8E-07 504 581

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 57 76 19
2 170 192 22
3 367 389 22
4 404 426 22
5 501 520 19
6 525 547 22
7 560 582 22
8 597 619 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.55 18.39 44.72
5d_25C Five days - 25 degrees Celsius 27.01 15.32 38.71
7d_25C Seven days - 25 degrees Celsius 28.54 16.37 40.71
10d_25C Ten days - 25 degrees Celsius 31.40 18.27 44.53
7d_15C Seven days - 15 degrees Celsius 24.88 13.75 36.00
7d_30C Seven days - 30 degrees Celsius 30.03 16.76 43.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.591392 no
3d_25C 7d_25C 0.749175 no
3d_25C 7d_15C 0.376568 no
3d_25C 7d_30C 0.887427 no
3d_25C 10d_25C 0.989642 no
5d_25C 7d_25C 0.878270 no
5d_25C 7d_15C 0.809461 no
5d_25C 7d_30C 0.743772 no
5d_25C 10d_25C 0.607782 no
7d_25C 7d_15C 0.655796 no
7d_25C 7d_30C 0.883980 no
7d_25C 10d_25C 0.764701 no
7d_15C 7d_30C 0.522791 no
7d_15C 10d_25C 0.395460 no
7d_30C 10d_25C 0.905455 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5655.t1
MPSIFAWLRRVYSLDTLDTRFTSSATPANTNTRPSTKDTRNAIAQGASPSLWRTPEFFVYYLFFITLVPLMFKTV
IDVSKESHPAYSTYSHLLSPGWIPGRQVDNSDVQYESFRDNIPALLLLLIAHPLARRVYQLHINRSNVGTKQSSY
SVVSAGEAQLEQRMRFDFWFGLFFIVGLHGVSAFKVLLILYINFRIGKDVPRAYVPTVTWVFNLGILFANELSGG
YSLERIAKVFSLGSGTSEDGATALVQWAQTLDHLGGLMPRWEVLFKVTVLRLISFNMDNYWSVDYPAGSLIEKKQ
LDPATLSDRDRVKIPAEPAAFTFRNYIAYVLYSPLYLAGPILTFNDYVSQQRYTSASLTRTRIVMYAVRFGLTVL
CMELILHYIYAVAISKANPDWSVFTPGQLSMLAFFNLHIIWLKLLIPWRFFRLWALVDGIDPPENMVRCMSNNYS
ALAFWRGWHRSYNRWIVRYIYIPLGGGGDGRRSPGAPKPASSRQSNFMGKFLQIRNFLLVFTFVALWHDINLRLL
MWGWLVTLFVLPEVLGGMFFPAYRWRSHPTAYRVICGIGSVGNVLMMMIANLVGFALGLDGLKDLLASLTGSYSG
LAYMISCCVVLFVGVQVMFEVREGELRAGINLKC*
Coding >Pro_DTO377G3_2|g5655.t1
ATGCCCTCCATTTTCGCCTGGCTTCGGCGGGTCTATTCGCTAGATACCCTTGACACTCGTTTCACCTCCTCCGCA
ACCCCTGCCAACACCAACACACGACCTTCCACCAAGGATACCCGCAATGCAATCGCCCAGGGCGCGTCACCTTCA
CTTTGGCGCACACCAGAATTCTTTGTCTACTACTTGTTCTTTATCACTCTTGTTCCATTGATGTTCAAGACCGTC
ATCGATGTCTCGAAAGAAAGCCACCCAGCCTACTCCACATACTCTCACCTTTTATCACCCGGTTGGATCCCTGGC
CGTCAGGTGGACAACTCCGATGTGCAATATGAAAGCTTTCGCGACAACATTCCTGCACTTCTACTACTCCTAATC
GCTCATCCTTTGGCTCGCCGCGTTTATCAGTTACACATCAACCGCTCGAATGTTGGAACAAAACAATCGAGCTAT
TCCGTGGTCAGTGCGGGCGAGGCGCAACTTGAACAGCGAATGCGCTTCGACTTTTGGTTCGGACTGTTCTTCATA
GTAGGGCTTCATGGAGTATCTGCTTTCAAAGTATTGTTGATTCTGTATATCAACTTCCGAATTGGCAAGGATGTT
CCGCGTGCCTACGTGCCTACCGTCACATGGGTCTTCAACCTCGGCATCTTGTTTGCCAACGAACTAAGCGGTGGC
TACTCCCTTGAGCGGATAGCAAAGGTGTTCTCTCTGGGGTCTGGGACGTCAGAAGATGGAGCCACCGCGCTAGTC
CAATGGGCTCAAACTCTCGATCATCTAGGGGGCTTGATGCCGCGATGGGAGGTACTTTTCAAGGTCACAGTGTTG
CGCCTCATCAGTTTCAACATGGATAATTACTGGAGTGTAGACTACCCTGCAGGAAGTCTAATTGAAAAGAAGCAA
CTAGACCCTGCGACCCTCTCTGACCGTGACCGGGTTAAGATCCCTGCAGAACCAGCTGCTTTTACATTCCGCAAC
TACATTGCCTATGTGCTCTACTCACCTTTGTATCTGGCGGGTCCGATCTTGACATTCAATGACTACGTATCTCAA
CAGCGATATACATCGGCGTCGCTCACACGAACTCGCATCGTGATGTACGCCGTCCGCTTTGGCCTCACCGTGCTC
TGCATGGAGCTCATCCTCCACTATATCTATGCAGTAGCAATCTCCAAAGCTAACCCAGACTGGTCTGTCTTCACC
CCGGGGCAACTGAGTATGCTTGCCTTCTTCAACCTGCACATAATCTGGCTGAAACTCCTCATCCCATGGCGATTC
TTCCGTCTTTGGGCTCTTGTAGACGGGATTGACCCACCAGAAAACATGGTTCGCTGCATGTCCAACAACTACTCC
GCCTTGGCCTTTTGGCGTGGCTGGCACCGCTCCTACAACCGCTGGATCGTCCGCTACATCTACATCCCACTGGGC
GGCGGCGGTGATGGCCGGCGGTCACCCGGGGCGCCCAAACCGGCTTCATCTCGACAGTCCAACTTCATGGGCAAG
TTCCTACAAATTCGCAACTTCCTGCTGGTCTTTACCTTCGTCGCCTTATGGCACGATATCAACCTCCGCTTGCTC
ATGTGGGGCTGGCTCGTTACTCTCTTCGTTCTACCAGAAGTTTTAGGCGGCATGTTTTTCCCGGCCTACCGCTGG
CGCTCTCATCCCACTGCGTACCGTGTCATCTGTGGCATTGGCTCCGTTGGGAACGTCCTTATGATGATGATAGCA
AACTTGGTCGGCTTTGCATTGGGTCTGGATGGACTAAAGGATCTGCTTGCCAGCCTAACAGGCTCATACTCTGGC
TTGGCGTATATGATTTCCTGCTGCGTCGTACTTTTCGTCGGCGTGCAGGTTATGTTTGAGGTTCGCGAAGGCGAG
CTTCGCGCGGGCATCAACCTGAAATGCTGA
Transcript >Pro_DTO377G3_2|g5655.t1
ATGCCCTCCATTTTCGCCTGGCTTCGGCGGGTCTATTCGCTAGATACCCTTGACACTCGTTTCACCTCCTCCGCA
ACCCCTGCCAACACCAACACACGACCTTCCACCAAGGATACCCGCAATGCAATCGCCCAGGGCGCGTCACCTTCA
CTTTGGCGCACACCAGAATTCTTTGTCTACTACTTGTTCTTTATCACTCTTGTTCCATTGATGTTCAAGACCGTC
ATCGATGTCTCGAAAGAAAGCCACCCAGCCTACTCCACATACTCTCACCTTTTATCACCCGGTTGGATCCCTGGC
CGTCAGGTGGACAACTCCGATGTGCAATATGAAAGCTTTCGCGACAACATTCCTGCACTTCTACTACTCCTAATC
GCTCATCCTTTGGCTCGCCGCGTTTATCAGTTACACATCAACCGCTCGAATGTTGGAACAAAACAATCGAGCTAT
TCCGTGGTCAGTGCGGGCGAGGCGCAACTTGAACAGCGAATGCGCTTCGACTTTTGGTTCGGACTGTTCTTCATA
GTAGGGCTTCATGGAGTATCTGCTTTCAAAGTATTGTTGATTCTGTATATCAACTTCCGAATTGGCAAGGATGTT
CCGCGTGCCTACGTGCCTACCGTCACATGGGTCTTCAACCTCGGCATCTTGTTTGCCAACGAACTAAGCGGTGGC
TACTCCCTTGAGCGGATAGCAAAGGTGTTCTCTCTGGGGTCTGGGACGTCAGAAGATGGAGCCACCGCGCTAGTC
CAATGGGCTCAAACTCTCGATCATCTAGGGGGCTTGATGCCGCGATGGGAGGTACTTTTCAAGGTCACAGTGTTG
CGCCTCATCAGTTTCAACATGGATAATTACTGGAGTGTAGACTACCCTGCAGGAAGTCTAATTGAAAAGAAGCAA
CTAGACCCTGCGACCCTCTCTGACCGTGACCGGGTTAAGATCCCTGCAGAACCAGCTGCTTTTACATTCCGCAAC
TACATTGCCTATGTGCTCTACTCACCTTTGTATCTGGCGGGTCCGATCTTGACATTCAATGACTACGTATCTCAA
CAGCGATATACATCGGCGTCGCTCACACGAACTCGCATCGTGATGTACGCCGTCCGCTTTGGCCTCACCGTGCTC
TGCATGGAGCTCATCCTCCACTATATCTATGCAGTAGCAATCTCCAAAGCTAACCCAGACTGGTCTGTCTTCACC
CCGGGGCAACTGAGTATGCTTGCCTTCTTCAACCTGCACATAATCTGGCTGAAACTCCTCATCCCATGGCGATTC
TTCCGTCTTTGGGCTCTTGTAGACGGGATTGACCCACCAGAAAACATGGTTCGCTGCATGTCCAACAACTACTCC
GCCTTGGCCTTTTGGCGTGGCTGGCACCGCTCCTACAACCGCTGGATCGTCCGCTACATCTACATCCCACTGGGC
GGCGGCGGTGATGGCCGGCGGTCACCCGGGGCGCCCAAACCGGCTTCATCTCGACAGTCCAACTTCATGGGCAAG
TTCCTACAAATTCGCAACTTCCTGCTGGTCTTTACCTTCGTCGCCTTATGGCACGATATCAACCTCCGCTTGCTC
ATGTGGGGCTGGCTCGTTACTCTCTTCGTTCTACCAGAAGTTTTAGGCGGCATGTTTTTCCCGGCCTACCGCTGG
CGCTCTCATCCCACTGCGTACCGTGTCATCTGTGGCATTGGCTCCGTTGGGAACGTCCTTATGATGATGATAGCA
AACTTGGTCGGCTTTGCATTGGGTCTGGATGGACTAAAGGATCTGCTTGCCAGCCTAACAGGCTCATACTCTGGC
TTGGCGTATATGATTTCCTGCTGCGTCGTACTTTTCGTCGGCGTGCAGGTTATGTTTGAGGTTCGCGAAGGCGAG
CTTCGCGCGGGCATCAACCTGAAATGCTGA
Gene >Pro_DTO377G3_2|g5655.t1
ATGCCCTCCATTTTCGCCTGGCTTCGGCGGGTCTATTCGCTAGATACCCTTGACACTCGTTTCACCTCCTCCGCA
ACCCCTGCCAACACCAACACACGACCTTCCACCAAGGATACCCGCAATGCAATCGCCCAGGGCGCGTCACCTTCA
CTTTGGCGCACACCAGAATTCTTTGTCTACTACTTGTTCTTTATCACTCTTGTTCCATTGATGTTCAAGACCGTC
ATCGATGTCTCGAAAGGTGAGTGTAGGCCGGAGAAAATGCTGGGCCTACAAATTCTGACAGCGGATCAACGTCAC
AGAAAGCCACCCAGCCTACTCCACATACTCTCACCTTTTATCACCCGGTTGGATCCCTGGCCGTCAGGTGGTAAG
TGTGCAACACTCGGCGTTCAGCTATTCATATCTATGAGGCCAGTCCCGACTGACATTATTGCTCTGGCCTTAGGA
CAACTCCGATGTGCAATATGAAAGCTTTCGCGACAACATTCCTGCACTTCTACTACTCCTAATCGCTCATCCTTT
GGCTCGCCGCGTTTATCAGTTACACATCAACCGCTCGAATGTTGGAACAAAACAATCGAGCTATTCCGTGGTCAG
TGCGGGCGAGGCGCAACTTGAACAGCGAATGCGCTTCGACTTTTGGTTCGGACTGTTCTTCATAGTAGGGCTTCA
TGGAGTATCTGCTTTCAAAGTATTGTTGATTCTGTATATCAACTTCCGAATTGGCAAGGATGTTCCGCGTGCCTA
CGTGCCTACCGTCACATGGGTCTTCAACCTCGGCATCTTGTTTGCCAACGAACTAAGCGGTGGCTACTCCCTTGA
GCGGATAGCAAAGGTGTTCTCTCTGGGGTCTGGGACGTCAGAAGATGGAGCCACCGCGCTAGTCCAATGGGCTCA
AACTCTCGATCATCTAGGGGGCTTGATGCCGCGATGGGAGGTACTTTTCAAGGTCACAGTGTTGCGCCTCATCAG
TTTCAACATGGATAATTACTGGAGTGTAGACTACCCTGCAGGAAGTCTAATTGAAGTAGGTCTTCCGAAGCCATC
AACCCCATGTGACAATCAAACTGACCGAATTCAACAAGAAGAAGCAACTAGACCCTGCGACCCTCTCTGACCGTG
ACCGGGTTAAGATCCCTGCAGAACCAGCTGCTTTTACATTCCGCAACTACATTGCCTATGTGCTCTACTCACCTT
TGTATCTGGCGGGTCCGATCTTGACATTCAATGACTACGTATCTCAACAGCGATATACATCGGCGTCGCTCACAC
GAACTCGCATCGTGATGTACGCCGTCCGCTTTGGCCTCACCGTGCTCTGCATGGAGCTCATCCTCCACTATATCT
ATGCAGTAGCAATCTCCAAAGCTAACCCAGACTGGTCTGTCTTCACCCCGGGGCAACTGAGTATGCTTGCCTTCT
TCAACCTGCACATAATCTGGCTGAAACTCCTCATCCCATGGCGATTCTTCCGTCTTTGGGCTCTTGTAGACGGGA
TTGACCCACCAGAAAACATGGTTCGCTGCATGTCCAACAACTACTCCGCCTTGGCCTTTTGGCGTGGCTGGCACC
GCTCCTACAACCGCTGGATCGTCCGCTACATCTACATCCCACTGGGCGGCGGCGGTGATGGCCGGCGGTCACCCG
GGGCGCCCAAACCGGCTTCATCTCGACAGTCCAACTTCATGGGCAAGTTCCTACAAATTCGCAACTTCCTGCTGG
TCTTTACCTTCGTCGCCTTATGGCACGATATCAACCTCCGCTTGCTCATGTGGGGCTGGCTCGTTACTCTCTTCG
TTCTACCAGAAGTTTTAGGCGGCATGTTTTTCCCGGCCTACCGCTGGCGCTCTCATCCCACTGCGTACCGTGTCA
TCTGTGGCATTGGCTCCGTTGGGAACGTCCTTATGATGATGATAGCAAACTTGGTCGGCTTTGCATTGGGTCTGG
ATGGACTAAAGGATCTGCTTGCCAGCCTAACAGGCTCATACTCTGGCTTGGCGTATATGATTTCCTGCTGCGTCG
TACTTTTCGTCGGCGTGCAGGTTATGTTTGAGGTTCGCGAAGGCGAGCTTCGCGCGGGCATCAACCTGAAATGCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail