Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5637.t1
Gene name
Locationscaffold_13:638666..639707
Strand+
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 6.4E-22 177 323

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0043167 ion binding No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0006629 lipid metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 87 109 22
2 137 159 22
3 166 188 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5637.t1
MNRNAKDSMKSTWRQQARSEWTLFHWFYEVLGIHPEHLDKNVPVHLKEDAVPYIPDWSMHRWVLTHAAIPLLIHH
AYVEITGHNLSAWGAFFLYGLAFKAIAIHEIHVLRRVGHQHGFLDGDKHARDGVPDVGVAKVVFSLMLTSTLRPM
FTVFIAYHATHPPSTISFLWLPLEAGLYGIVLDFWFYWYHRLMHDVGALWKYHRTHHLTKHPNPLLTLYADSEQE
FFDILGIPLMTYFSMRAVGMPMGFYEWWVCHQYVVFAELAGHSGLRVHATPPSTLSWALRWFGAELVIEDHDLHH
RKGWRKSHNYGKQTRLWDRVFGTCTDRVESVENNVDYVNSSPMPLY*
Coding >Pro_DTO377G3_2|g5637.t1
ATGAATCGTAACGCAAAAGACTCCATGAAGTCCACCTGGCGGCAGCAAGCCCGCTCAGAGTGGACACTCTTCCAC
TGGTTCTACGAAGTCCTCGGCATCCACCCCGAACACCTCGACAAGAACGTGCCCGTCCATCTAAAGGAAGATGCC
GTGCCGTACATCCCAGACTGGTCCATGCACCGCTGGGTGCTCACGCACGCCGCCATCCCCCTCCTGATCCACCAC
GCGTACGTCGAGATCACCGGCCACAACCTCAGCGCCTGGGGCGCCTTCTTCCTCTACGGCCTCGCCTTCAAAGCC
ATCGCCATCCACGAAATCCACGTCCTACGACGAGTAGGCCACCAGCACGGCTTCCTAGACGGCGACAAGCACGCG
CGCGACGGCGTCCCAGACGTCGGCGTCGCCAAGGTCGTCTTCTCACTCATGTTAACATCAACCCTCCGCCCAATG
TTCACCGTCTTCATCGCCTACCACGCCACACACCCGCCCTCCACGATCAGCTTCCTCTGGCTGCCCCTCGAAGCC
GGGCTGTACGGTATCGTCCTCGACTTCTGGTTCTACTGGTACCACCGACTGATGCATGACGTGGGCGCGTTGTGG
AAATACCACCGCACGCACCACCTCACCAAGCATCCGAACCCGCTGCTGACGCTGTACGCGGACTCGGAGCAGGAG
TTCTTTGATATCCTCGGCATCCCGCTTATGACGTATTTCAGCATGCGGGCTGTGGGCATGCCGATGGGGTTTTAT
GAGTGGTGGGTTTGCCATCAGTATGTGGTATTCGCGGAGTTGGCGGGGCATAGTGGGCTGCGGGTTCATGCTACG
CCGCCGTCGACGTTGAGTTGGGCTTTGCGGTGGTTTGGGGCGGAGCTTGTTATTGAGGATCATGATTTGCATCAT
CGGAAGGGTTGGAGGAAGAGTCATAACTATGGGAAGCAGACGAGGCTTTGGGATCGGGTCTTTGGGACTTGTACT
GATCGTGTTGAATCGGTTGAGAACAATGTTGATTATGTCAATTCGTCGCCTATGCCGTTGTATTGA
Transcript >Pro_DTO377G3_2|g5637.t1
ATGAATCGTAACGCAAAAGACTCCATGAAGTCCACCTGGCGGCAGCAAGCCCGCTCAGAGTGGACACTCTTCCAC
TGGTTCTACGAAGTCCTCGGCATCCACCCCGAACACCTCGACAAGAACGTGCCCGTCCATCTAAAGGAAGATGCC
GTGCCGTACATCCCAGACTGGTCCATGCACCGCTGGGTGCTCACGCACGCCGCCATCCCCCTCCTGATCCACCAC
GCGTACGTCGAGATCACCGGCCACAACCTCAGCGCCTGGGGCGCCTTCTTCCTCTACGGCCTCGCCTTCAAAGCC
ATCGCCATCCACGAAATCCACGTCCTACGACGAGTAGGCCACCAGCACGGCTTCCTAGACGGCGACAAGCACGCG
CGCGACGGCGTCCCAGACGTCGGCGTCGCCAAGGTCGTCTTCTCACTCATGTTAACATCAACCCTCCGCCCAATG
TTCACCGTCTTCATCGCCTACCACGCCACACACCCGCCCTCCACGATCAGCTTCCTCTGGCTGCCCCTCGAAGCC
GGGCTGTACGGTATCGTCCTCGACTTCTGGTTCTACTGGTACCACCGACTGATGCATGACGTGGGCGCGTTGTGG
AAATACCACCGCACGCACCACCTCACCAAGCATCCGAACCCGCTGCTGACGCTGTACGCGGACTCGGAGCAGGAG
TTCTTTGATATCCTCGGCATCCCGCTTATGACGTATTTCAGCATGCGGGCTGTGGGCATGCCGATGGGGTTTTAT
GAGTGGTGGGTTTGCCATCAGTATGTGGTATTCGCGGAGTTGGCGGGGCATAGTGGGCTGCGGGTTCATGCTACG
CCGCCGTCGACGTTGAGTTGGGCTTTGCGGTGGTTTGGGGCGGAGCTTGTTATTGAGGATCATGATTTGCATCAT
CGGAAGGGTTGGAGGAAGAGTCATAACTATGGGAAGCAGACGAGGCTTTGGGATCGGGTCTTTGGGACTTGTACT
GATCGTGTTGAATCGGTTGAGAACAATGTTGATTATGTCAATTCGTCGCCTATGCCGTTGTATTGA
Gene >Pro_DTO377G3_2|g5637.t1
ATGAATCGTAACGCAAAAGACTCCATGAAGTCCACCTGGCGGCAGCAAGCCCGCTCAGAGTGGACACTCTTCCAC
TGGTTCTACGAAGTCCTCGGCATCCACCCCGAACACCTCGACAAGAACGTGCCCGTCCATCTAAAGGAAGATGCC
GTGCCGTACATCCCAGACTGGTCCATGCACCGCTGGGTGCTCACGCACGCCGCCATCCCCCTCCTGATCCACCAC
GCGTACGTCGAGATCACCGGCCACAACCTCAGCGCCTGGGGCGCCTTCTTCCTCTACGGCCTCGCCTTCAAAGCC
ATCGCCATCCACGAAATCCACGTCCTACGACGAGTAGGCCACCAGCACGGCTTCCTAGACGGCGACAAGCACGCG
CGCGACGGCGTCCCAGACGTCGGCGTCGCCAAGGTCGTCTTCTCACTCATGTTAACATCAACCCTCCGCCCAATG
TTCACCGTCTTCATCGCCTACCACGCCACACACCCGCCCTCCACGATCAGCTTCCTCTGGCTGCCCCTCGAAGCC
GGGCTGTACGGTATCGTCCTCGACTTCTGGTTCTACTGGTACCACCGACTGATGCATGACGTGGGCGCGTTGTGG
AAATACCACCGCACGCACCACCTCACCAAGCATCCGAACCCGCTGCTGACGCTGTACGCGGACTCGGAGCAGGAG
TTCTTTGATATCCTCGGCATCCCGCTTATGACGTATTTCAGCATGCGGGCTGTGGGCATGCCGATGGGGTTTTAT
GAGTGGTGGGTTTGCCATCAGTATGTGGTATTCGCGGAGTTGGCGGGGCATAGTGGGCTGCGGGTTCATGCTACG
CCGCCGTCGACGTTGAGTTGGGCTTTGCGGTGGTTTGGGGCGGAGCTTGTTATTGAGGATCATGATTTGCATCAT
CGGAAGGGTTGGAGGAAGAGTCATAACTATGGGAAGCAGACGAGGCTTTGGGATCGGGTCTTTGGGACTTGTACT
GATCGTGTTGAATCGGTTGAGAACAATGTTGATTATGTCAATTCGTCGCCTATGCCGTTGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail