Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g561.t1
Gene name
Locationscaffold_01:1444072..1452887
Strand+
Gene length (bp)8815
Transcript length (bp)8688
Coding sequence length (bp)8688
Protein length (aa) 2896

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10344 Fmp27 Mitochondrial protein from FMP27 6.7E-244 17 871
PF10351 Apt1 Golgi-body localisation protein domain 3.3E-191 2179 2736
PF10359 Fmp27_WPPW RNA pol II promoter Fmp27 protein domain 1.5E-175 1638 2166
PF10347 Fmp27_GFWDK RNA pol II promoter Fmp27 protein domain 4.6E-55 1233 1392
PF10293 DUF2405 Domain of unknown function (DUF2405) 4.2E-54 887 1043
PF10305 Fmp27_SW RNA pol II promoter Fmp27 protein domain 2.9E-28 1114 1215

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g561.t1
MTLFNPTSILVGFLLLYLSSFFIFAIVRIATGISIQRIGYFSLRRIAYTPKEGIHIEIRGLGLLLHPPSFAQPTW
ISIRLTELKVTVDSTTLGQGKRDAPRQPSEDHAAPEPGGRSKTWRTLTRIKERVKRLHRQIHWLALVDLTAIDTT
VHFVNAGQIQVGSLSLSVDTRRKMVERGKLFRRKKDMSQDQRPAEWIMNAKNVLLNVDGREPTEILDNVGVNLHG
LLHKDLDGLRDASVALKIGRLHIPYDDLRTLLQRIKPVKKSAQGSNTETDDEISFADFVDELDKPGSRDNAIIQT
VADSKGFASSLLRGVQEIQIALSFFRVSKGIQALSAGQTPVYLNVVSHELGIDLHRMDQRSPEHRMYFQRNDVAH
QALLAAISLSVSLGDESGETDNILYIPMATTTIKTTLPSKTVSTFDDGNAEERNTNVLFANLVVTSPSVDLQPQH
VSRLLKLAQNRASSPRAKKRDNHRLISRLLPKASINISVHEPVVRFVLPIEKESGTPDDYNLLISSISSISLDIE
SSHSSEGGAHYSLSSIYRVASHKFYYQTPAGNKHNLLTNENLELKAHLNATPEVCVIASGSLNECSVHMIDGDVN
RGIREVLQQFITQMQSQKRVPIPTNEKKASVLRRVPPWLLQFQFEATGSSVEVAGVDSTVSDISRGVSLQLQSWT
AEYKAQKTETNVGSIARRRTPSHSTIGDESPFRFPPTSPPKATHTQRGASDGRRLAFHARGFDGFVIESEDYLEP
EPFFSLPRFEIALSTHCDRLGPLLHVTSVFKGIYLQYSLYRFYCLGVAVSVIQDVLTPLPPKHSEAAENKPRAPA
SVSLPPPPAYKWSPKKELVTYDMKATVVQLKANLPNDPQIMIQIYGLAGASQRLSTPYVKANLVRFHAEAPKLKG
VWARIGSMNNVRLDFRKMKMKHGNTLVEEKSIDIWTDFIRIGVPHHMVMHRIFDNLINTSKALKQLHHRFKNGCR
DFGSLREPEGPKKVPRISIRSKALLFELEDDGFEWKLGCIYRVGLVEQIQRLAREDAFQLKSHKVMESDQRRASS
RSRAKSSHRTMRSERTSLDTRRSRSADERPRSSAQERGRGRKYRYDTEGATCLSSEQKISVHSAWGRLQQYNAQV
WKEKIDAALMFQGTSIKQVRNLFSGADEPPPDVKETETILAIPNRPGLMSALISDVHLVIDKPSFAIDEFPSYLN
RIGKGMPMSMKYGLLIPMSFNLEMGEARVNLRDYPLDLLHIPALRPGQSPRLPSWSLRTNFVIAEEWRDHESARQ
VEVELVPASEGFDGSPRDAFKIQVWRSVTPVKTYSDPVIEINTSLPTSISWGVSYQPVIQDMMKIIEGFTKPEID
PSERVGFWDKIRLSFHSRIKVLWREDGDVHLRLKGSRDPYVVTGFGSGFVMCWRRDVQLDVHTSDNPMEFMTVTS
GEYVLAIPDYSAEARWANEATTEEVDNSSASSEQKNAAQFKKVIMKLSGDVKWAAGLVFERDSENDERSFSFKPH
YEVILKNPRFVKPSEQINYDAYRGFRSDHIHLSVSIIAPQNRDWAVDNVQPSSSYNTIHLSPRFFTHFFNWWSLF
SGVMSLPVRQGSLWPGVTKTAKKFNRHLATVKYKILLAPLFVAHMYKHKDREDYEERAVVATGLKVRLDCLKLDI
HQRREQIKTQAGGRSKQTRTTAMRINQAQIDMQSADFRAVSASIEGTTPEDVERNKDDILSSFQQPVPSVDLSRF
TIPDHNLDWVDMDDFVEPDWILPQESNPRTQILPLAFTPRFTYFRNTDHCDIGPDETGYSPFGDEPTHECVMSET
NDPRRVQIELVKDRLATVEAQIRNYESTIGEIEIKLMKEVDNNTELKAEHELFLRQSESLARRRKFLTTTLNRLE
RHITRDERTPYGDTLGKNVAPSTASFRTGRTGTTDGRSSALDGIYSSANDEFSSDFDNRFMIHNMQLKWNNSLRN
IVLRYSHQVSQRRGFVYYMSRRAVKFILDIVEEQDKSDRKQPKMSKTQTRSSSVDEDEEEVGDRIEQLLNDAKRY
VNVEENDPPDSNNQSTPNTPSSANSDSSSENIVPEFTPQNTYHLRLIAPQIQLLSEKNQKSVLLVAAKGMELKVV
SIMDKGRVSDDVSGLIQRRFSLEMDGAQFFVATQKKLMTNLQFYAGNKYGNAPGSAWPPWLTLEAMFDFELNPFG
FSRIVQKTSATLRYDKFNNLRLKYNEEVNKNQEGPQPDDQEDRIDSISVDFPHFRAICDSAEYYSMYIIVLDLML
YSEPLEKVRNERLERIMLTSDFSDLSGAPEMVFKLQARIRQLEEIKEYFQINAKFLDKQGWEDRLALERDLSLCE
DELFFMMKAITTSQRRMEPSSSRDAGVHGLLRWSISASEVVWHLMKEASEPLIEFQLRNASYERTDNTDGSNHNL
VSIERLVGLNLLPDAIYPQIIAPYLDGGRTLDDFMLRIKWHMLEAVAGIPVLDNFEVSLFPLKIQLERELGQKVF
EYVFPNVGSSAFEAGGFSPFMIKNMKPLEASDGEDDDEGPNGEGPNGAPLTRSTSIDGDSSSMDSLAISKGPGSI
ELRLQPTLSLLDETKPPRHRSGHLKGLMMTPIHQDSNRLGVSETARKTGRPSTTGGLRKKKSADSLRMLTKHPTE
RSMSSHSASEDSRKKFGIGKGTNKGGKSKEQTDDLTQMISRASNFMTLAHVKVNDVVLCLSYKGRGEHNLEDLHD
FVFRLPVLEYSNKTWSNLDLALRLKKDVIKALISHAPAILGNKFSHHRPSKQQQKRFRELASSSQLLPDTFSLMK
QNNDQAHSLASYDSNSDYSESRSRRSMQSNASPLARTTSLNSDPHGTDYSDPTIHDSRSASDVDVDSRWEASRRF
VNAPPPERPMTSGNTVTTIRSGKNDQDDSHIKTIRNIGRKLTFRK*
Coding >Pro_DTO377G3_2|g561.t1
ATGACCCTCTTTAACCCGACCTCGATTCTCGTGGGATTCCTCCTCCTTTACCTCTCGTCCTTTTTCATCTTCGCT
ATCGTCCGGATCGCGACGGGAATCTCTATCCAACGGATCGGCTACTTTTCGCTGCGCCGAATTGCATACACCCCG
AAGGAAGGAATACACATTGAAATCCGTGGCCTCGGATTGTTGTTACACCCCCCGTCATTTGCCCAGCCAACATGG
ATCAGCATTCGGTTGACAGAACTGAAGGTGACCGTGGACTCGACGACTCTGGGCCAGGGAAAACGCGACGCACCG
CGTCAACCATCCGAAGACCACGCCGCCCCCGAACCTGGCGGCAGAAGCAAAACATGGAGGACGTTAACACGAATC
AAGGAACGTGTCAAGCGGCTACACCGGCAGATCCATTGGTTGGCCCTCGTGGACCTGACTGCTATCGACACAACC
GTCCACTTTGTCAACGCTGGCCAAATCCAGGTGGGATCGCTTTCTCTTTCAGTCGACACGCGGAGGAAGATGGTG
GAACGGGGCAAGCTATTTCGTCGCAAGAAGGATATGTCGCAAGACCAACGCCCAGCCGAGTGGATTATGAATGCC
AAAAATGTTTTACTCAATGTCGACGGCCGGGAGCCAACCGAGATATTGGATAATGTTGGTGTGAATCTCCATGGA
CTTCTTCACAAGGATTTGGACGGACTGAGAGACGCCTCGGTGGCCCTTAAAATTGGGCGTTTGCATATTCCATAT
GACGATCTCCGCACGCTATTGCAGCGCATCAAACCGGTCAAGAAATCTGCACAGGGGTCAAATACGGAGACCGAT
GACGAGATATCATTTGCCGATTTCGTGGACGAACTCGACAAGCCTGGAAGCAGAGACAATGCCATTATACAGACA
GTGGCGGACTCAAAGGGGTTTGCAAGCTCATTACTTCGTGGTGTACAGGAGATACAGATTGCTTTGAGCTTCTTC
CGTGTCTCAAAGGGTATCCAGGCTCTGTCTGCAGGACAAACCCCCGTATATCTGAATGTGGTATCGCATGAGCTT
GGAATTGATCTTCATCGGATGGACCAAAGAAGCCCAGAGCATCGCATGTATTTCCAGCGGAATGATGTTGCCCAT
CAGGCTCTTCTTGCTGCTATCTCTCTTTCCGTCAGCTTAGGCGACGAATCGGGCGAGACCGATAACATTCTATAC
ATCCCCATGGCTACGACAACCATCAAAACCACACTGCCTTCGAAGACGGTGAGCACCTTCGATGATGGGAATGCT
GAAGAGCGAAACACAAATGTCCTGTTCGCAAATTTGGTCGTGACATCACCCTCGGTTGATCTCCAACCGCAACAT
GTTTCGAGGCTGCTTAAACTAGCACAAAATCGAGCTTCTTCTCCTCGGGCGAAGAAGCGAGATAATCATCGATTG
ATTTCTCGACTACTCCCGAAGGCAAGCATCAATATTTCTGTTCACGAACCTGTGGTCCGGTTTGTTCTCCCCATC
GAGAAAGAGTCTGGTACTCCCGATGATTACAACCTCCTTATTTCCTCGATCTCCTCTATTTCACTCGATATCGAG
TCCTCTCATTCATCTGAAGGCGGTGCCCACTATTCCCTATCGTCAATTTACCGGGTCGCCTCCCACAAATTCTAT
TACCAGACTCCAGCAGGCAACAAACACAATTTGCTCACAAACGAGAATCTGGAGCTGAAGGCCCATTTGAACGCC
ACTCCAGAGGTCTGTGTAATCGCCTCAGGAAGTCTTAACGAGTGTTCAGTCCACATGATTGATGGGGATGTAAAC
CGTGGAATCCGCGAAGTCTTGCAGCAATTCATCACCCAGATGCAATCACAGAAGCGGGTACCAATACCGACAAAT
GAAAAAAAGGCAAGCGTGTTGAGACGAGTGCCACCATGGCTACTCCAATTTCAGTTCGAAGCCACAGGGTCCAGT
GTGGAAGTCGCTGGTGTGGACAGCACCGTTTCTGATATATCTCGTGGTGTATCTCTGCAACTACAATCGTGGACA
GCGGAATACAAAGCTCAAAAAACGGAGACAAATGTCGGAAGCATTGCTAGGCGACGCACTCCGAGCCATTCCACC
ATTGGCGATGAATCGCCCTTTCGATTTCCCCCAACCTCGCCTCCTAAGGCTACTCACACACAACGCGGCGCTTCA
GATGGCCGGCGACTGGCTTTCCACGCGCGTGGTTTCGATGGCTTTGTCATTGAATCAGAGGATTATCTGGAACCC
GAGCCATTCTTCTCTTTGCCTCGATTCGAGATTGCGCTGAGCACCCACTGTGATCGCCTCGGACCGCTCCTGCAT
GTCACATCCGTGTTCAAGGGCATATACCTTCAATACTCACTGTACCGGTTCTACTGCCTCGGCGTTGCCGTTTCC
GTGATCCAAGACGTGCTCACACCCTTACCGCCAAAGCACTCAGAGGCTGCCGAAAACAAACCCAGGGCGCCTGCG
AGTGTCTCGCTACCGCCGCCTCCGGCATACAAATGGTCTCCAAAAAAGGAGCTTGTCACATACGACATGAAGGCA
ACAGTTGTGCAGCTCAAGGCAAACCTGCCAAACGATCCTCAAATAATGATTCAGATCTACGGACTTGCCGGTGCT
TCTCAACGTCTTTCTACTCCTTATGTTAAAGCCAACCTTGTCCGCTTCCATGCAGAGGCACCTAAGCTCAAGGGT
GTTTGGGCAAGAATCGGAAGTATGAACAACGTCAGGCTGGATTTCCGAAAGATGAAGATGAAACATGGCAACACT
TTGGTGGAAGAAAAATCTATCGACATATGGACAGACTTCATCCGAATTGGTGTACCTCATCATATGGTGATGCAC
CGCATTTTTGATAACCTTATCAACACTTCCAAGGCTTTGAAACAGCTGCATCATCGCTTCAAGAATGGTTGCAGA
GATTTCGGCTCCTTGAGAGAACCAGAAGGCCCGAAGAAGGTGCCTAGGATATCTATTCGCAGCAAAGCGTTGCTC
TTCGAGTTGGAGGACGATGGCTTTGAGTGGAAACTGGGCTGCATCTATCGAGTTGGCCTGGTTGAACAGATTCAG
CGGCTGGCCCGGGAAGACGCCTTCCAGTTGAAATCTCACAAAGTCATGGAATCTGACCAGCGGCGTGCCTCATCT
CGGTCACGAGCCAAGTCGAGCCATCGGACAATGCGCAGCGAGCGAACTAGCCTAGATACAAGGCGAAGCAGGAGT
GCCGATGAACGCCCGAGATCTAGCGCCCAAGAACGCGGGAGAGGTCGGAAATACCGCTATGATACCGAAGGCGCC
ACCTGTCTCTCATCGGAGCAAAAGATCTCTGTGCATTCTGCCTGGGGCCGACTTCAACAGTACAATGCTCAAGTC
TGGAAAGAGAAGATCGATGCAGCTCTCATGTTCCAGGGCACTTCTATCAAACAAGTCCGAAATCTCTTCTCTGGT
GCAGATGAACCTCCTCCGGATGTGAAAGAGACCGAAACCATTCTTGCCATTCCGAACAGACCGGGTCTGATGTCG
GCTCTGATCAGTGATGTTCACCTTGTTATTGACAAGCCTTCATTCGCTATCGATGAGTTCCCCAGTTACTTGAAC
CGAATCGGAAAGGGGATGCCTATGTCTATGAAATACGGCCTGCTCATCCCAATGAGCTTTAACCTGGAAATGGGT
GAAGCACGCGTCAACTTGCGAGATTATCCCCTAGATCTATTGCACATCCCAGCCCTGCGCCCAGGGCAGTCCCCA
AGACTTCCCAGCTGGTCTTTGCGGACGAACTTTGTCATTGCAGAAGAATGGCGTGACCATGAATCCGCAAGACAG
GTTGAAGTGGAACTCGTTCCTGCATCTGAAGGGTTCGACGGATCCCCCCGCGATGCGTTCAAGATTCAGGTGTGG
CGTTCTGTTACACCAGTCAAGACCTATTCGGACCCTGTCATCGAGATAAACACAAGTTTGCCGACTAGCATTTCA
TGGGGTGTCTCCTATCAGCCTGTTATTCAAGATATGATGAAGATCATTGAGGGTTTCACGAAACCTGAAATTGAT
CCCTCGGAGCGGGTGGGCTTCTGGGACAAGATCCGACTCAGCTTTCACTCCCGGATCAAGGTTCTCTGGAGGGAA
GATGGCGATGTACATCTGCGACTTAAGGGCTCTCGTGATCCGTATGTGGTGACCGGCTTTGGAAGCGGCTTCGTC
ATGTGCTGGCGTAGAGATGTCCAATTGGATGTGCACACCAGTGACAATCCCATGGAATTCATGACTGTCACGAGC
GGCGAATATGTGCTCGCTATTCCCGACTACAGTGCCGAAGCACGTTGGGCAAACGAAGCTACCACAGAGGAGGTG
GATAACAGTTCTGCATCCAGCGAGCAGAAGAATGCTGCCCAATTCAAAAAGGTTATTATGAAGCTCTCTGGCGAT
GTCAAGTGGGCAGCAGGTCTCGTCTTCGAGCGGGATAGTGAGAATGATGAAAGGTCCTTCTCCTTCAAACCACAT
TATGAGGTCATTCTTAAGAACCCCAGATTCGTCAAACCATCCGAGCAGATCAATTACGATGCCTATCGTGGCTTC
CGGAGTGACCATATTCACCTTTCTGTCTCGATTATTGCACCGCAGAATAGAGACTGGGCTGTCGACAATGTGCAA
CCGTCTTCAAGCTACAACACAATCCATCTCTCACCGCGATTCTTCACCCACTTCTTCAATTGGTGGTCTCTTTTC
TCGGGCGTGATGTCGCTTCCTGTTCGCCAAGGATCGCTCTGGCCAGGAGTCACAAAGACCGCCAAGAAGTTCAAT
CGTCATTTGGCGACTGTCAAATACAAGATTCTTCTTGCACCCCTTTTCGTGGCCCATATGTACAAGCACAAGGAT
CGCGAAGATTATGAAGAGAGAGCTGTTGTGGCCACGGGCTTGAAAGTTCGCCTTGATTGCTTGAAACTTGATATC
CATCAACGTCGCGAGCAAATCAAAACACAAGCCGGGGGCCGTTCAAAACAGACCAGGACAACCGCGATGCGTATT
AATCAAGCCCAAATTGATATGCAATCTGCAGACTTCCGCGCCGTGTCCGCCAGCATCGAAGGCACAACACCGGAA
GACGTTGAGCGCAACAAAGACGATATCCTCTCTTCCTTCCAACAGCCTGTTCCATCAGTTGACTTGTCTCGTTTC
ACAATCCCTGATCACAATTTGGACTGGGTCGACATGGATGATTTCGTGGAGCCGGACTGGATCCTTCCACAGGAG
TCGAACCCCCGTACCCAGATCTTACCTTTGGCCTTCACCCCGCGATTCACCTACTTCCGCAACACGGATCACTGC
GACATCGGACCCGACGAAACGGGCTACAGTCCATTTGGGGACGAACCGACCCACGAGTGTGTCATGTCTGAAACC
AACGATCCTCGCCGTGTTCAGATTGAGTTGGTCAAAGACCGCCTTGCAACAGTCGAGGCACAGATTCGCAATTAT
GAAAGCACAATTGGGGAAATCGAAATCAAGCTTATGAAAGAAGTAGACAATAATACAGAACTGAAAGCCGAGCAT
GAGTTATTCCTTCGCCAGTCTGAGTCTCTAGCGAGACGACGCAAGTTCTTGACCACAACTCTCAATCGTCTTGAG
AGACATATCACACGCGACGAGCGGACTCCATATGGCGACACACTTGGCAAAAACGTTGCACCCAGCACTGCTTCT
TTCCGAACAGGACGAACAGGTACAACCGATGGCCGTTCTTCAGCCTTGGATGGAATTTACTCGTCGGCCAACGAT
GAGTTCTCCAGCGATTTCGACAATCGTTTCATGATCCACAACATGCAGCTCAAATGGAACAACTCGCTCCGCAAC
ATCGTATTGCGGTATAGTCACCAAGTGAGCCAGCGGCGTGGATTTGTCTACTACATGTCTCGCCGCGCTGTCAAA
TTTATCCTTGATATCGTGGAAGAACAGGACAAGAGCGATCGCAAGCAGCCTAAAATGTCCAAGACACAAACCCGA
AGTTCGAGCGTCGATGAGGATGAGGAGGAGGTTGGAGATCGCATTGAACAGTTGCTGAATGATGCTAAGCGCTAC
GTGAATGTCGAAGAGAACGATCCACCAGACTCGAACAACCAATCAACTCCGAACACCCCATCCTCTGCCAATTCG
GACAGTTCGAGTGAGAATATCGTGCCGGAATTCACTCCCCAGAACACTTATCACTTGCGTCTCATTGCACCTCAA
ATACAGCTTCTTAGTGAAAAGAACCAGAAGTCGGTCTTGCTTGTTGCCGCTAAAGGCATGGAACTCAAGGTCGTG
TCAATCATGGACAAAGGGCGTGTTTCGGATGATGTCAGCGGCTTGATACAACGCCGTTTCTCCCTCGAAATGGAC
GGTGCCCAGTTTTTCGTTGCAACACAGAAGAAATTGATGACAAACTTGCAATTCTATGCTGGCAATAAGTACGGG
AATGCGCCTGGATCAGCGTGGCCACCGTGGTTGACTTTGGAAGCCATGTTTGATTTCGAGTTGAATCCATTTGGA
TTCTCTCGTATTGTGCAAAAGACTTCTGCCACCCTGCGTTACGACAAGTTCAACAATCTTCGCCTCAAGTATAAC
GAAGAGGTGAACAAGAATCAGGAAGGACCTCAACCTGACGACCAAGAAGACCGCATAGACTCGATTAGTGTGGAC
TTCCCTCATTTCCGCGCGATTTGTGATTCTGCAGAGTACTATTCCATGTACATTATTGTCCTGGACCTCATGCTC
TACAGCGAACCACTCGAAAAGGTCCGAAATGAGCGCCTAGAGAGGATCATGCTCACTTCCGACTTCAGTGACCTT
AGTGGCGCCCCGGAAATGGTGTTCAAGCTTCAAGCACGCATTCGCCAGTTGGAAGAAATCAAAGAGTACTTTCAG
ATCAACGCTAAGTTCCTTGACAAACAGGGCTGGGAGGATCGGCTGGCCCTCGAACGCGACTTGTCTCTATGCGAG
GATGAACTTTTCTTCATGATGAAGGCAATCACAACTTCCCAACGGCGAATGGAACCGAGTTCGTCCAGGGACGCC
GGTGTCCATGGCTTACTGCGTTGGAGCATATCGGCGAGCGAGGTCGTGTGGCACCTGATGAAGGAGGCTTCTGAG
CCCTTGATTGAGTTCCAATTGCGCAATGCTTCATATGAGCGAACCGACAATACTGATGGCTCGAACCATAACCTG
GTATCCATCGAACGACTAGTCGGGTTGAACTTACTTCCAGACGCTATCTACCCTCAAATCATCGCGCCTTACCTC
GACGGCGGACGCACCCTCGATGACTTCATGTTGCGCATCAAATGGCACATGCTGGAGGCCGTTGCCGGTATCCCT
GTGCTTGACAACTTTGAAGTTTCATTGTTCCCGCTGAAGATTCAGCTCGAACGCGAGCTGGGCCAGAAAGTCTTC
GAATACGTCTTCCCCAACGTGGGTTCTAGCGCCTTTGAGGCTGGTGGTTTCTCGCCTTTCATGATCAAGAACATG
AAGCCACTTGAAGCTTCAGATGGGGAAGACGATGACGAAGGCCCCAACGGCGAAGGCCCCAACGGCGCACCACTG
ACACGCTCAACGAGTATCGATGGTGATAGCTCGTCTATGGACAGTCTCGCCATCTCTAAGGGACCGGGCTCCATC
GAACTGCGCCTCCAGCCGACACTGTCACTTTTAGATGAGACCAAGCCGCCGCGTCATCGCTCAGGCCATCTGAAG
GGTCTGATGATGACACCTATCCACCAAGATAGTAATCGACTGGGTGTCTCGGAGACCGCGCGCAAAACGGGCCGT
CCCTCTACAACTGGTGGTCTCCGCAAGAAGAAGTCTGCTGATAGTCTGCGCATGTTGACTAAACATCCCACCGAA
AGATCCATGTCTAGCCACAGTGCTAGCGAAGACAGTCGCAAGAAGTTCGGAATAGGTAAAGGGACCAACAAGGGC
GGCAAATCCAAAGAGCAAACCGATGACCTGACCCAAATGATCTCCCGCGCCTCCAACTTCATGACTCTCGCACAT
GTGAAGGTGAATGACGTAGTTCTTTGTCTGAGCTACAAGGGCAGAGGCGAGCACAATCTAGAGGATCTCCACGAT
TTCGTCTTCCGCCTTCCAGTTCTCGAGTATAGTAACAAGACATGGTCGAACCTGGATCTTGCCTTGCGCCTCAAG
AAAGACGTGATTAAAGCCCTCATCTCGCACGCGCCCGCCATTCTTGGCAACAAGTTCTCCCACCACCGACCTTCG
AAGCAGCAACAGAAGCGTTTCCGTGAGCTTGCATCCTCGTCTCAACTCCTGCCAGACACATTCAGCTTGATGAAA
CAGAACAATGATCAAGCCCATAGTCTGGCCAGCTACGACTCTAATAGCGATTACTCGGAGTCCCGCTCGCGCAGA
TCCATGCAGTCGAATGCCTCGCCATTGGCTAGGACGACCTCGTTGAATTCAGATCCCCACGGCACAGATTATTCA
GATCCCACCATCCATGACTCGCGGTCCGCTAGTGATGTGGATGTGGATTCTCGCTGGGAGGCGTCGCGTCGATTT
GTCAATGCCCCTCCACCCGAAAGGCCGATGACATCCGGTAACACCGTGACTACGATACGATCTGGCAAGAATGAT
CAGGATGATAGTCACATCAAAACAATTCGCAACATCGGCCGGAAGCTGACATTCCGGAAATGA
Transcript >Pro_DTO377G3_2|g561.t1
ATGACCCTCTTTAACCCGACCTCGATTCTCGTGGGATTCCTCCTCCTTTACCTCTCGTCCTTTTTCATCTTCGCT
ATCGTCCGGATCGCGACGGGAATCTCTATCCAACGGATCGGCTACTTTTCGCTGCGCCGAATTGCATACACCCCG
AAGGAAGGAATACACATTGAAATCCGTGGCCTCGGATTGTTGTTACACCCCCCGTCATTTGCCCAGCCAACATGG
ATCAGCATTCGGTTGACAGAACTGAAGGTGACCGTGGACTCGACGACTCTGGGCCAGGGAAAACGCGACGCACCG
CGTCAACCATCCGAAGACCACGCCGCCCCCGAACCTGGCGGCAGAAGCAAAACATGGAGGACGTTAACACGAATC
AAGGAACGTGTCAAGCGGCTACACCGGCAGATCCATTGGTTGGCCCTCGTGGACCTGACTGCTATCGACACAACC
GTCCACTTTGTCAACGCTGGCCAAATCCAGGTGGGATCGCTTTCTCTTTCAGTCGACACGCGGAGGAAGATGGTG
GAACGGGGCAAGCTATTTCGTCGCAAGAAGGATATGTCGCAAGACCAACGCCCAGCCGAGTGGATTATGAATGCC
AAAAATGTTTTACTCAATGTCGACGGCCGGGAGCCAACCGAGATATTGGATAATGTTGGTGTGAATCTCCATGGA
CTTCTTCACAAGGATTTGGACGGACTGAGAGACGCCTCGGTGGCCCTTAAAATTGGGCGTTTGCATATTCCATAT
GACGATCTCCGCACGCTATTGCAGCGCATCAAACCGGTCAAGAAATCTGCACAGGGGTCAAATACGGAGACCGAT
GACGAGATATCATTTGCCGATTTCGTGGACGAACTCGACAAGCCTGGAAGCAGAGACAATGCCATTATACAGACA
GTGGCGGACTCAAAGGGGTTTGCAAGCTCATTACTTCGTGGTGTACAGGAGATACAGATTGCTTTGAGCTTCTTC
CGTGTCTCAAAGGGTATCCAGGCTCTGTCTGCAGGACAAACCCCCGTATATCTGAATGTGGTATCGCATGAGCTT
GGAATTGATCTTCATCGGATGGACCAAAGAAGCCCAGAGCATCGCATGTATTTCCAGCGGAATGATGTTGCCCAT
CAGGCTCTTCTTGCTGCTATCTCTCTTTCCGTCAGCTTAGGCGACGAATCGGGCGAGACCGATAACATTCTATAC
ATCCCCATGGCTACGACAACCATCAAAACCACACTGCCTTCGAAGACGGTGAGCACCTTCGATGATGGGAATGCT
GAAGAGCGAAACACAAATGTCCTGTTCGCAAATTTGGTCGTGACATCACCCTCGGTTGATCTCCAACCGCAACAT
GTTTCGAGGCTGCTTAAACTAGCACAAAATCGAGCTTCTTCTCCTCGGGCGAAGAAGCGAGATAATCATCGATTG
ATTTCTCGACTACTCCCGAAGGCAAGCATCAATATTTCTGTTCACGAACCTGTGGTCCGGTTTGTTCTCCCCATC
GAGAAAGAGTCTGGTACTCCCGATGATTACAACCTCCTTATTTCCTCGATCTCCTCTATTTCACTCGATATCGAG
TCCTCTCATTCATCTGAAGGCGGTGCCCACTATTCCCTATCGTCAATTTACCGGGTCGCCTCCCACAAATTCTAT
TACCAGACTCCAGCAGGCAACAAACACAATTTGCTCACAAACGAGAATCTGGAGCTGAAGGCCCATTTGAACGCC
ACTCCAGAGGTCTGTGTAATCGCCTCAGGAAGTCTTAACGAGTGTTCAGTCCACATGATTGATGGGGATGTAAAC
CGTGGAATCCGCGAAGTCTTGCAGCAATTCATCACCCAGATGCAATCACAGAAGCGGGTACCAATACCGACAAAT
GAAAAAAAGGCAAGCGTGTTGAGACGAGTGCCACCATGGCTACTCCAATTTCAGTTCGAAGCCACAGGGTCCAGT
GTGGAAGTCGCTGGTGTGGACAGCACCGTTTCTGATATATCTCGTGGTGTATCTCTGCAACTACAATCGTGGACA
GCGGAATACAAAGCTCAAAAAACGGAGACAAATGTCGGAAGCATTGCTAGGCGACGCACTCCGAGCCATTCCACC
ATTGGCGATGAATCGCCCTTTCGATTTCCCCCAACCTCGCCTCCTAAGGCTACTCACACACAACGCGGCGCTTCA
GATGGCCGGCGACTGGCTTTCCACGCGCGTGGTTTCGATGGCTTTGTCATTGAATCAGAGGATTATCTGGAACCC
GAGCCATTCTTCTCTTTGCCTCGATTCGAGATTGCGCTGAGCACCCACTGTGATCGCCTCGGACCGCTCCTGCAT
GTCACATCCGTGTTCAAGGGCATATACCTTCAATACTCACTGTACCGGTTCTACTGCCTCGGCGTTGCCGTTTCC
GTGATCCAAGACGTGCTCACACCCTTACCGCCAAAGCACTCAGAGGCTGCCGAAAACAAACCCAGGGCGCCTGCG
AGTGTCTCGCTACCGCCGCCTCCGGCATACAAATGGTCTCCAAAAAAGGAGCTTGTCACATACGACATGAAGGCA
ACAGTTGTGCAGCTCAAGGCAAACCTGCCAAACGATCCTCAAATAATGATTCAGATCTACGGACTTGCCGGTGCT
TCTCAACGTCTTTCTACTCCTTATGTTAAAGCCAACCTTGTCCGCTTCCATGCAGAGGCACCTAAGCTCAAGGGT
GTTTGGGCAAGAATCGGAAGTATGAACAACGTCAGGCTGGATTTCCGAAAGATGAAGATGAAACATGGCAACACT
TTGGTGGAAGAAAAATCTATCGACATATGGACAGACTTCATCCGAATTGGTGTACCTCATCATATGGTGATGCAC
CGCATTTTTGATAACCTTATCAACACTTCCAAGGCTTTGAAACAGCTGCATCATCGCTTCAAGAATGGTTGCAGA
GATTTCGGCTCCTTGAGAGAACCAGAAGGCCCGAAGAAGGTGCCTAGGATATCTATTCGCAGCAAAGCGTTGCTC
TTCGAGTTGGAGGACGATGGCTTTGAGTGGAAACTGGGCTGCATCTATCGAGTTGGCCTGGTTGAACAGATTCAG
CGGCTGGCCCGGGAAGACGCCTTCCAGTTGAAATCTCACAAAGTCATGGAATCTGACCAGCGGCGTGCCTCATCT
CGGTCACGAGCCAAGTCGAGCCATCGGACAATGCGCAGCGAGCGAACTAGCCTAGATACAAGGCGAAGCAGGAGT
GCCGATGAACGCCCGAGATCTAGCGCCCAAGAACGCGGGAGAGGTCGGAAATACCGCTATGATACCGAAGGCGCC
ACCTGTCTCTCATCGGAGCAAAAGATCTCTGTGCATTCTGCCTGGGGCCGACTTCAACAGTACAATGCTCAAGTC
TGGAAAGAGAAGATCGATGCAGCTCTCATGTTCCAGGGCACTTCTATCAAACAAGTCCGAAATCTCTTCTCTGGT
GCAGATGAACCTCCTCCGGATGTGAAAGAGACCGAAACCATTCTTGCCATTCCGAACAGACCGGGTCTGATGTCG
GCTCTGATCAGTGATGTTCACCTTGTTATTGACAAGCCTTCATTCGCTATCGATGAGTTCCCCAGTTACTTGAAC
CGAATCGGAAAGGGGATGCCTATGTCTATGAAATACGGCCTGCTCATCCCAATGAGCTTTAACCTGGAAATGGGT
GAAGCACGCGTCAACTTGCGAGATTATCCCCTAGATCTATTGCACATCCCAGCCCTGCGCCCAGGGCAGTCCCCA
AGACTTCCCAGCTGGTCTTTGCGGACGAACTTTGTCATTGCAGAAGAATGGCGTGACCATGAATCCGCAAGACAG
GTTGAAGTGGAACTCGTTCCTGCATCTGAAGGGTTCGACGGATCCCCCCGCGATGCGTTCAAGATTCAGGTGTGG
CGTTCTGTTACACCAGTCAAGACCTATTCGGACCCTGTCATCGAGATAAACACAAGTTTGCCGACTAGCATTTCA
TGGGGTGTCTCCTATCAGCCTGTTATTCAAGATATGATGAAGATCATTGAGGGTTTCACGAAACCTGAAATTGAT
CCCTCGGAGCGGGTGGGCTTCTGGGACAAGATCCGACTCAGCTTTCACTCCCGGATCAAGGTTCTCTGGAGGGAA
GATGGCGATGTACATCTGCGACTTAAGGGCTCTCGTGATCCGTATGTGGTGACCGGCTTTGGAAGCGGCTTCGTC
ATGTGCTGGCGTAGAGATGTCCAATTGGATGTGCACACCAGTGACAATCCCATGGAATTCATGACTGTCACGAGC
GGCGAATATGTGCTCGCTATTCCCGACTACAGTGCCGAAGCACGTTGGGCAAACGAAGCTACCACAGAGGAGGTG
GATAACAGTTCTGCATCCAGCGAGCAGAAGAATGCTGCCCAATTCAAAAAGGTTATTATGAAGCTCTCTGGCGAT
GTCAAGTGGGCAGCAGGTCTCGTCTTCGAGCGGGATAGTGAGAATGATGAAAGGTCCTTCTCCTTCAAACCACAT
TATGAGGTCATTCTTAAGAACCCCAGATTCGTCAAACCATCCGAGCAGATCAATTACGATGCCTATCGTGGCTTC
CGGAGTGACCATATTCACCTTTCTGTCTCGATTATTGCACCGCAGAATAGAGACTGGGCTGTCGACAATGTGCAA
CCGTCTTCAAGCTACAACACAATCCATCTCTCACCGCGATTCTTCACCCACTTCTTCAATTGGTGGTCTCTTTTC
TCGGGCGTGATGTCGCTTCCTGTTCGCCAAGGATCGCTCTGGCCAGGAGTCACAAAGACCGCCAAGAAGTTCAAT
CGTCATTTGGCGACTGTCAAATACAAGATTCTTCTTGCACCCCTTTTCGTGGCCCATATGTACAAGCACAAGGAT
CGCGAAGATTATGAAGAGAGAGCTGTTGTGGCCACGGGCTTGAAAGTTCGCCTTGATTGCTTGAAACTTGATATC
CATCAACGTCGCGAGCAAATCAAAACACAAGCCGGGGGCCGTTCAAAACAGACCAGGACAACCGCGATGCGTATT
AATCAAGCCCAAATTGATATGCAATCTGCAGACTTCCGCGCCGTGTCCGCCAGCATCGAAGGCACAACACCGGAA
GACGTTGAGCGCAACAAAGACGATATCCTCTCTTCCTTCCAACAGCCTGTTCCATCAGTTGACTTGTCTCGTTTC
ACAATCCCTGATCACAATTTGGACTGGGTCGACATGGATGATTTCGTGGAGCCGGACTGGATCCTTCCACAGGAG
TCGAACCCCCGTACCCAGATCTTACCTTTGGCCTTCACCCCGCGATTCACCTACTTCCGCAACACGGATCACTGC
GACATCGGACCCGACGAAACGGGCTACAGTCCATTTGGGGACGAACCGACCCACGAGTGTGTCATGTCTGAAACC
AACGATCCTCGCCGTGTTCAGATTGAGTTGGTCAAAGACCGCCTTGCAACAGTCGAGGCACAGATTCGCAATTAT
GAAAGCACAATTGGGGAAATCGAAATCAAGCTTATGAAAGAAGTAGACAATAATACAGAACTGAAAGCCGAGCAT
GAGTTATTCCTTCGCCAGTCTGAGTCTCTAGCGAGACGACGCAAGTTCTTGACCACAACTCTCAATCGTCTTGAG
AGACATATCACACGCGACGAGCGGACTCCATATGGCGACACACTTGGCAAAAACGTTGCACCCAGCACTGCTTCT
TTCCGAACAGGACGAACAGGTACAACCGATGGCCGTTCTTCAGCCTTGGATGGAATTTACTCGTCGGCCAACGAT
GAGTTCTCCAGCGATTTCGACAATCGTTTCATGATCCACAACATGCAGCTCAAATGGAACAACTCGCTCCGCAAC
ATCGTATTGCGGTATAGTCACCAAGTGAGCCAGCGGCGTGGATTTGTCTACTACATGTCTCGCCGCGCTGTCAAA
TTTATCCTTGATATCGTGGAAGAACAGGACAAGAGCGATCGCAAGCAGCCTAAAATGTCCAAGACACAAACCCGA
AGTTCGAGCGTCGATGAGGATGAGGAGGAGGTTGGAGATCGCATTGAACAGTTGCTGAATGATGCTAAGCGCTAC
GTGAATGTCGAAGAGAACGATCCACCAGACTCGAACAACCAATCAACTCCGAACACCCCATCCTCTGCCAATTCG
GACAGTTCGAGTGAGAATATCGTGCCGGAATTCACTCCCCAGAACACTTATCACTTGCGTCTCATTGCACCTCAA
ATACAGCTTCTTAGTGAAAAGAACCAGAAGTCGGTCTTGCTTGTTGCCGCTAAAGGCATGGAACTCAAGGTCGTG
TCAATCATGGACAAAGGGCGTGTTTCGGATGATGTCAGCGGCTTGATACAACGCCGTTTCTCCCTCGAAATGGAC
GGTGCCCAGTTTTTCGTTGCAACACAGAAGAAATTGATGACAAACTTGCAATTCTATGCTGGCAATAAGTACGGG
AATGCGCCTGGATCAGCGTGGCCACCGTGGTTGACTTTGGAAGCCATGTTTGATTTCGAGTTGAATCCATTTGGA
TTCTCTCGTATTGTGCAAAAGACTTCTGCCACCCTGCGTTACGACAAGTTCAACAATCTTCGCCTCAAGTATAAC
GAAGAGGTGAACAAGAATCAGGAAGGACCTCAACCTGACGACCAAGAAGACCGCATAGACTCGATTAGTGTGGAC
TTCCCTCATTTCCGCGCGATTTGTGATTCTGCAGAGTACTATTCCATGTACATTATTGTCCTGGACCTCATGCTC
TACAGCGAACCACTCGAAAAGGTCCGAAATGAGCGCCTAGAGAGGATCATGCTCACTTCCGACTTCAGTGACCTT
AGTGGCGCCCCGGAAATGGTGTTCAAGCTTCAAGCACGCATTCGCCAGTTGGAAGAAATCAAAGAGTACTTTCAG
ATCAACGCTAAGTTCCTTGACAAACAGGGCTGGGAGGATCGGCTGGCCCTCGAACGCGACTTGTCTCTATGCGAG
GATGAACTTTTCTTCATGATGAAGGCAATCACAACTTCCCAACGGCGAATGGAACCGAGTTCGTCCAGGGACGCC
GGTGTCCATGGCTTACTGCGTTGGAGCATATCGGCGAGCGAGGTCGTGTGGCACCTGATGAAGGAGGCTTCTGAG
CCCTTGATTGAGTTCCAATTGCGCAATGCTTCATATGAGCGAACCGACAATACTGATGGCTCGAACCATAACCTG
GTATCCATCGAACGACTAGTCGGGTTGAACTTACTTCCAGACGCTATCTACCCTCAAATCATCGCGCCTTACCTC
GACGGCGGACGCACCCTCGATGACTTCATGTTGCGCATCAAATGGCACATGCTGGAGGCCGTTGCCGGTATCCCT
GTGCTTGACAACTTTGAAGTTTCATTGTTCCCGCTGAAGATTCAGCTCGAACGCGAGCTGGGCCAGAAAGTCTTC
GAATACGTCTTCCCCAACGTGGGTTCTAGCGCCTTTGAGGCTGGTGGTTTCTCGCCTTTCATGATCAAGAACATG
AAGCCACTTGAAGCTTCAGATGGGGAAGACGATGACGAAGGCCCCAACGGCGAAGGCCCCAACGGCGCACCACTG
ACACGCTCAACGAGTATCGATGGTGATAGCTCGTCTATGGACAGTCTCGCCATCTCTAAGGGACCGGGCTCCATC
GAACTGCGCCTCCAGCCGACACTGTCACTTTTAGATGAGACCAAGCCGCCGCGTCATCGCTCAGGCCATCTGAAG
GGTCTGATGATGACACCTATCCACCAAGATAGTAATCGACTGGGTGTCTCGGAGACCGCGCGCAAAACGGGCCGT
CCCTCTACAACTGGTGGTCTCCGCAAGAAGAAGTCTGCTGATAGTCTGCGCATGTTGACTAAACATCCCACCGAA
AGATCCATGTCTAGCCACAGTGCTAGCGAAGACAGTCGCAAGAAGTTCGGAATAGGTAAAGGGACCAACAAGGGC
GGCAAATCCAAAGAGCAAACCGATGACCTGACCCAAATGATCTCCCGCGCCTCCAACTTCATGACTCTCGCACAT
GTGAAGGTGAATGACGTAGTTCTTTGTCTGAGCTACAAGGGCAGAGGCGAGCACAATCTAGAGGATCTCCACGAT
TTCGTCTTCCGCCTTCCAGTTCTCGAGTATAGTAACAAGACATGGTCGAACCTGGATCTTGCCTTGCGCCTCAAG
AAAGACGTGATTAAAGCCCTCATCTCGCACGCGCCCGCCATTCTTGGCAACAAGTTCTCCCACCACCGACCTTCG
AAGCAGCAACAGAAGCGTTTCCGTGAGCTTGCATCCTCGTCTCAACTCCTGCCAGACACATTCAGCTTGATGAAA
CAGAACAATGATCAAGCCCATAGTCTGGCCAGCTACGACTCTAATAGCGATTACTCGGAGTCCCGCTCGCGCAGA
TCCATGCAGTCGAATGCCTCGCCATTGGCTAGGACGACCTCGTTGAATTCAGATCCCCACGGCACAGATTATTCA
GATCCCACCATCCATGACTCGCGGTCCGCTAGTGATGTGGATGTGGATTCTCGCTGGGAGGCGTCGCGTCGATTT
GTCAATGCCCCTCCACCCGAAAGGCCGATGACATCCGGTAACACCGTGACTACGATACGATCTGGCAAGAATGAT
CAGGATGATAGTCACATCAAAACAATTCGCAACATCGGCCGGAAGCTGACATTCCGGAAATGA
Gene >Pro_DTO377G3_2|g561.t1
ATGACCCTCTTTAACCCGACCTCGATTCTCGTGGGATTCCTCCTCCTTTACCTCTCGTCCTTTTTCATCTTCGCT
ATCGTCCGGATCGCGACGGGAATCTCTATCCAACGGATCGGCTACTTTTCGCTGCGCCGAATTGCATACACCCCG
AAGGAAGGAATACACATTGAAATCCGTGGCCTCGGATTGTTGTTACACCCCCCGTCATTTGCCCAGCCAACATGG
ATCAGCATTCGGTTGACAGAACTGAAGGTGACCGTGGACTCGACGACTCTGGGCCAGGGAAAACGCGACGCACCG
CGTCAACCATCCGAAGACCACGCCGCCCCCGAACCTGGCGGCAGAAGCAAAACATGGAGGACGTTAACACGAATC
AAGGAACGTGTCAAGCGGCTACACCGGCAGATCCATTGGTTGGCCCTCGTGGACCTGACTGCTATCGACACAACC
GTCCACTTTGTCAACGCTGGCCAAATCCAGGTGGGATCGCTTTCTCTTTCAGTCGACACGCGGAGGAAGATGGTG
GAACGGGGCAAGCTATTTCGTCGCAAGAAGGATATGTCGCAAGACCAACGCCCAGCCGAGTGGATTATGAATGCC
AAAAATGTTTTACTCAATGTCGACGGCCGGGAGCCAACCGAGATATTGGATAATGTTGGTGTGAATCTCCATGGA
CTTCTTCACAAGGATTTGGACGGACTGAGAGACGCCTCGGTGGCCCTTAAAATTGGGCGTTTGCATATTCCATAT
GACGATCTCCGCACGCTATTGCAGCGCATCAAACCGGTCAAGAAATCTGCACAGGGGTCAAATACGGAGACCGAT
GACGAGATATCATTTGCCGATTTCGTGGACGAACTCGACAAGCCTGGAAGCAGAGACAATGCCATTATACAGACA
GTGGCGGACTCAAAGGGGTTTGCAAGCTCATTACTTCGTGGTGTACAGGAGATACAGATTGCTTTGAGCTTCTTC
CGTGTCTCAAAGGGTATCCAGGCTCTGTCTGCAGGACAAACCCCCGTATATCTGAATGTGGTATCGCATGAGCTT
GGAATTGATCTTCATCGGATGGACCAAAGAAGCCCAGAGCATCGCATGTATTTCCAGCGGAATGATGTTGCCCAT
CAGGCTCTTCTTGCTGCTATCTCTCTTTCCGTCAGCTTAGGCGACGAATCGGGCGAGACCGATAACATTCTATAC
ATCCCCATGGCTACGACAACCATCAAAACCACACTGCCTTCGAAGACGGTGAGCACCTTCGATGATGGGAATGCT
GAAGAGCGAAACACAAATGTCCTGTTCGCAAATTTGGTCGTGACATCACCCTCGGTTGATCTCCAACCGCAACAT
GTTTCGAGGCTGCTTAAACTAGCACAAAATCGAGCTTCTTCTCCTCGGGCGAAGAAGCGAGATAATCATCGATTG
ATTTCTCGACTACTCCCGAAGGCAAGCATCAATATTTCTGTTCACGAACCTGTGGTCCGGTTTGTTCTCCCCATC
GAGAAAGAGTCTGGTACTCCCGATGATTACAACCTCCTTATTTCCTCGATCTCCTCTATTTCACTCGATATCGAG
TCCTCTCATTCATCTGAAGGCGGTGCCCACTATTCCCTATCGTCAATTTACCGGGTCGCCTCCCACAAATTCTAT
TACCAGACTCCAGCAGGCAACAAACACAATTTGCTCACAAACGAGAATCTGGAGCTGAAGGCCCATTTGAACGCC
ACTCCAGAGGTCTGTGTAATCGCCTCAGGAAGTCTTAACGAGTGTTCAGTCCACATGATTGATGGGGATGTAAAC
CGTGGAATCCGCGAAGTCTTGCAGCAATTCATCACCCAGATGCAATCACAGAAGCGGGTACCAATACCGACAAAT
GAAAAAAAGGCAAGCGTGTTGAGACGAGTGCCACCATGGCTACTCCAATTTCAGTTCGAAGCCACAGGGTCCAGT
GTGGAAGTCGCTGGTGTGGACAGCACCGTTTCTGATATATCTCGTGGTGTATCTCTGCAACTACAATCGTGGACA
GCGGAATACAAAGCTCAAAAAACGGAGACAAATGTCGGAAGCATTGCTAGGCGACGCACTCCGAGCCATTCCACC
ATTGGCGATGAATCGCCCTTTCGATTTCCCCCAACCTCGCCTCCTAAGGCTACTCACACACAACGCGGCGCTTCA
GATGGCCGGCGACTGGCTTTCCACGCGCGTGGTTTCGATGGCTTTGTCATTGAATCAGAGGATTATCTGGAACCC
GAGCCATTCTTCTCTTTGCCTCGATTCGAGATTGCGCTGAGCACCCACTGTGATCGCCTCGGACCGCTCCTGCAT
GTCACATCCGTGTTCAAGGGCATATACCTTCAATACTCACTGTACCGGTTCTACTGCCTCGGCGTTGCCGTTTCC
GTGATCCAAGACGTGCTCACACCCTTACCGCCAAAGCACTCAGAGGCTGCCGAAAACAAACCCAGGGCGCCTGCG
AGTGTCTCGCTACCGCCGCCTCCGGCATACAAATGGTCTCCAAAAAAGGAGCTTGTCACATACGACATGAAGGCA
ACAGTTGTGCAGCTCAAGGCAAACCTGCCAAACGATCCTCAAATAATGATTCAGATCTACGGACTTGCCGGTGCT
TCTCAACGTCTTTCTACTCCTTATGTTAAAGCCAACCTTGTCCGCTTCCATGCAGAGGCACCTAAGCTCAAGGGT
GTTTGGGCAAGAATCGGAAGTATGAACAACGTCAGGCTGGATTTCCGAAAGATGAAGATGAAACATGGCAACACT
TTGGTGGAAGAAAAATCTATCGACATATGGACAGACTTCATCCGAATTGGTGTACCTCATCATATGGTGATGCAC
CGCATTTTTGATAACCTTATCAACACTTCCAAGGCTTTGAAACAGCTGCATCATCGCTTCAAGAATGGTTGCAGA
GATTTCGGCTCCTTGAGAGAACCAGAAGGCCCGAAGAAGGTGCCTAGGATATCTATTCGCAGCAAAGCGTTGCTC
TTCGAGTTGGAGGACGATGGCTTTGAGTGGAAACTGGGCTGCATCTATCGAGTTGGCCTGGTTGAACAGATTCAG
CGGCTGGCCCGGGAAGACGCCTTCCAGTTGAAATCTCACAAAGTCATGGAATCTGACCAGCGGCGTGCCTCATCT
CGGTCACGAGCCAAGTCGAGCCATCGGACAATGCGCAGCGAGCGAACTAGCCTAGATACAAGGCGAAGCAGGAGT
GCCGATGAACGCCCGAGATCTAGCGCCCAAGAACGCGGGAGAGGTCGGAAATACCGCTATGATACCGAAGGCGCC
ACCTGTCTCTCATCGGAGCAAAAGATCTCTGTGCATTCTGCCTGGGGCCGACTTCAACAGTACAATGCTCAAGTC
TGGAAAGAGAAGATCGATGCAGCTCTCATGTTCCAGGGCACTTCTATCAAACAAGTCCGAAATCTCTTCTCTGGT
GCAGATGAACCTCCTCCGGATGTGAAAGAGACCGAAACCATTCTTGCCATTCCGAACAGACCGGGTCTGATGTCG
GCTCTGATCAGTGATGTTCACCTTGTTATTGACAAGCCTTCATTCGCTATCGATGAGTTCCCCAGTTACTTGAAC
CGAATCGGAAAGGGGATGCCTATGTCTATGAAATACGGCCTGCTCATCCCAATGAGCTTTAACCTGGAAATGGGT
GAAGCACGCGTCAACTTGCGAGATTATCCCCTAGATCTATTGCACATCCCAGCCCTGCGCCCAGGGCAGTCCCCA
AGACTTCCCAGCTGGTCTTTGCGGACGAACTTTGTCATTGCAGAAGAATGGCGTGACCATGAATCCGCAAGACAG
GTTGAAGTGGAACTCGTTCCTGCATCTGAAGGGTTCGACGGATCCCCCCGCGATGCGTTCAAGATTCAGGTGTGG
CGTTCTGTTACACCAGTCAAGACCTATTCGGACCCTGTCATCGAGATAAACACAAGTTTGCCGACTAGCATTTCA
TGGGGTGTCTCCTATCAGCCTGTTATTCAAGATATGATGAAGATCATTGAGGGTTTCACGAAACCTGAAATTGAT
CCCTCGGAGCGGGTGGGCTTCTGGGACAAGATCCGACTCAGCTTTCACTCCCGGATCAAGGTTCTCTGGAGGGAA
GATGGCGATGTACATCTGCGACTTAAGGGCTCTCGTGATCCGTATGTGGTGACCGGCTTTGGAAGCGGCTTCGTC
ATGTGCTGGCGTAGAGATGTCCAATTGGATGTGCACACCAGTGACAATCCCATGGAATTCATGACTGTCACGAGC
GGCGAATATGTGCTCGCTATTCCCGACTACAGTGCCGAAGCACGTTGGGCAAACGAAGCTACCACAGAGGAGGTG
GATAACAGTTCTGCATCCAGCGAGCAGAAGAATGCTGCCCAATTCAAAAAGGTTATTATGAAGCTCTCTGGCGAT
GTCAAGTGGGCAGCAGGTCTCGTCTTCGAGCGGGATAGTGAGAATGATGAAAGGTCCTTCTCCTTCAAACCACAT
TATGAGGTCATTCTTAAGAACCCCAGATTCGTCAAACCATCCGAGCAGATCAATTACGATGCCTATCGTGGCTTC
CGGAGTGACCATATTCACCTTTCTGTCTCGATTATTGCACCGCAGAATAGAGACTGGGCTGTCGACAATGTGCAA
CCGTCTTCAAGCTACAACACAATCCATCTCTCACCGCGATTCTTCACCCACTTCTTCAATTGGTGGTCTCTTTTC
TCGGGCGTGATGTCGCTTCCTGTTCGCCAAGGATCGCTCTGGCCAGGAGTCACAAAGACCGCCAAGAAGTTCAAT
CGTCATTTGGCGACTGTCAAATACAAGATTCTTCTTGCACCCCTTTTCGTGGCCCATATGTACAAGCACAAGGAT
CGCGAAGATTATGAAGAGAGAGCTGTTGTGGCCACGGGCTTGAAAGTTCGCCTTGATTGCTTGAAACTTGATATC
CATCAACGTCGCGAGCAAATCAAAACACAAGCCGGGGGCCGTTCAAAACAGACCAGGACAACCGCGATGCGTATT
AATCAAGCCCAAATTGATATGCAATCTGCAGACTTCCGCGCCGTGTCCGCCAGCATCGAAGGCACAACACCGGAA
GACGTTGAGCGCAACAAAGACGATATCCTCTCTTCCTTCCAACAGCCTGTTCCATCAGTTGACTTGTCTCGTTTC
ACAATCCCTGATCACAATTTGGACTGGGTCGACATGGATGATTTCGTGGAGCCGGACTGGATCCTTCCACAGGAG
TCGAACCCCCGTACCCAGATCTTACCTTTGGCCTTCACCCCGCGATTCACCTACTTCCGCAACACGGATCACTGC
GACATCGGACCCGACGAAACGGGCTACAGTCCATTTGGGGACGAACCGACCCACGAGTGTGTCATGTCTGAAACC
AACGATCCTCGCCGTGTTCAGATTGAGTTGGTCAAAGACCGCCTTGCAACAGTCGAGGCACAGATTCGCAATTAT
GAAAGCACAATTGGGGAAATCGAAATCAAGCTTATGAAAGAAGTAGACAATAATACAGAACTGAAAGCCGAGCAT
GAGTTATTCCTTCGCCAGTCTGAGTCTCTAGCGAGACGACGCAAGTTCTTGACCACAACTCTCAATCGTCTTGAG
AGACATATCACACGCGACGAGCGGACTCCATATGGCGACACACTTGGCAAAAACGTTGCACCCAGCACTGCTTCT
TTCCGAACAGGACGAACAGGTACAACCGATGGCCGTTCTTCAGCCTTGGATGGAATTTACTCGTCGGCCAACGAT
GAGTTCTCCAGCGATTTCGACAATCGTTTCATGATCCACAACATGCAGCTCAAATGGAACAACTCGCTCCGCAAC
ATCGTATTGCGGTATAGTCACCAAGTGAGCCAGCGGCGTGGATTTGTCTACTACATGTCTCGCCGCGCTGTCAAA
TTTATCCTTGATATCGTGGAAGAACAGGACAAGAGCGATCGCAAGCAGCCTAAAATGTCCAAGACACAAACCCGA
AGTTCGAGCGTCGATGAGGATGAGGAGGAGGTTGGAGATCGCATTGAACAGTTGCTGAATGATGCTAAGCGCTAC
GTGAATGTCGAAGAGAACGATCCACCAGACTCGAACAACCAATCAACTCCGAACACCCCATCCTCTGCCAATTCG
GACAGTTCGAGTGAGAATATCGTGCCGGAATTCACTCCCCAGAACACTTATCACTTGCGTCTCATTGCACCTCAA
ATACAGCTTCTTAGTGAAAAGAACCAGAAGTCGGTCTTGCTTGTTGCCGCTAAAGGCATGGAACTCAAGGTCGTG
TCAATCATGGACAAAGGGCGTGTTTCGGATGATGTCAGCGGCTTGATACAACGCCGTTTCTCCCTCGAAATGGAC
GGTGCCCAGTTTTTCGTTGCAACACAGAAGAAATTGATGACAAACTTGCAATTCTATGCTGGCAATAAGTACGGG
AATGCGCCTGGATCAGCGTGGCCACCGTGGTTGACTTTGGAAGCCATGTTTGATTTCGAGTTGAATCCATTTGGA
TTCTCTCGTATTGTGCAAAAGACTTCTGCCACCCTGCGTTACGACAAGTTCAACAATCTTCGCCTCAAGTATAAC
GAAGAGGTGAACAAGAATCAGGAAGGACCTCAACCTGACGACCAAGAAGACCGCATAGACTCGATTAGTGTGGAC
TTCCCTCATTTCCGCGCGATTTGTGATTCTGCAGAGTACTATTCCATGTACATTATTGTCCTGGACCTCATGCTC
TACAGCGAACCACTCGAAAAGGTCCGAAATGAGCGCCTAGAGAGGATCATGCTCACTTCCGACTTCAGTGACCTT
AGTGGCGCCCCGGAAATGGTGTTCAAGCTTCAAGCACGCATTCGCCAGTTGGAAGAAATCAAAGAGTACTTTCAG
ATCAACGCTAAGTTCCTTGACAAACAGGGCTGGGAGGATCGGCTGGCCCTCGAACGCGACTTGTCTCTATGCGAG
GATGAACTTTTCTTCATGATGAAGGCAATCACAACTTCCCAACGGCGAATGGAACCGAGTTCGTCCAGGGACGCC
GGTGTCCATGGCTTACTGCGTTGGAGCATATCGGCGAGCGAGGTCGTGTGGCACCTGATGAAGGAGGCTTCTGAG
CCCTTGATTGAGTTCCAATTGCGCAATGCTTCATATGAGCGAACCGACAATACTGATGGCTCGAACCATAACCTG
GTATCCATCGAACGACTAGTCGGGTTGAACTTACTTCCAGACGCTATCTACCCTCAAATCATCGCGCCTTACCTC
GACGGCGGACGCACCCTCGATGACTTCATGTTGCGCATCAAATGGCACATGCTGGAGGCCGTTGCCGGTATCCCT
GTGCTTGACAACTTTGAAGTTTCATTGTTCCCGCTGAAGATTCAGCTCGAACGCGAGCTGGGCCAGAAAGTCTTC
GAATACGTCTTCCCCAACGTGGGTTCTAGCGCCTTTGAGGCTGGTGGTTTCTCGCCTTTCATGATCAAGAACATG
AAGCCACTTGAAGCTTCAGATGGGGAAGACGATGACGAAGGCCCCAACGGCGAAGGCCCCAACGGCGCACCACTG
ACACGCTCAACGAGTATCGATGGTGATAGCTCGTCTATGGACAGTCTCGCCATCTCTAAGGGACCGGGCTCCATC
GAACTGCGCCTCCAGCCGACACTGTCACTTTTAGATGAGACCAAGCCGCCGCGTCATCGCTCAGGCCATCTGAAG
GGTCTGATGATGACACCTATCCACCAAGATAGTAATCGACTGGGTGTCTCGGAGACCGCGCGCAAAACGGGCCGT
CCCTCTACAACTGGTGGTCTCCGCAAGAAGAAGTCTGCTGATAGTCTGCGCATGTTGACTAAACATCCCACCGAA
AGATCCATGTCTAGCCACAGTGCTAGCGAAGACAGTCGCAAGAAGTTCGGAATAGGTAAAGGGACCAACAAGGGC
GGCAAATCCAAAGAGCAAACCGATGACCTGACCCAAATGATCTCCCGCGCCTCCAACTTCATGACTCTCGCACAT
GTGAAGGTGAATGACGTAGTTCTTTGTCTGAGCTACAAGGGCAGAGGCGAGCACAATCTAGAGGATCTCCACGAT
TTCGTCTTCCGCCTTCCAGTTCTCGAGTATAGTAACAAGACATGGTCGAACCTGGATCTTGCCTTGCGCCTCAAG
AAAGACGTGATTAAAGCCCTCATCTCGCACGCGCCCGCCATTCTTGGCAACAAGTTCTCCCACCACCGACCTTCG
AAGCAGCAACAGAAGCGTTTCCGTGAGCTTGCATCCTCGTCTCAACTCCTGCCAGACACATTCAGCTTGATGAAA
CAGAACAATGATCAAGCCCATAGTCTGGCCAGCTACGACTCTAATAGCGATTACTCGGAGTCCCGCTCGCGCAGA
TCCATGCAGTCGAATGCCTCGCCATTGGCTAGGACGACCTCGTTGAATTCAGATCCCCACGGCACAGATTATTCA
GATCCCACCATCCATGACTCGCGGTCCGCTAGTGATGTGGATGTGGATTCTCGCTGGGAGGTTCGTGTTCTTTCG
TCTCACCGTGTCACCGTGAATATCCCCGAATGCTAATACAGAATGTTTAGGCGTCGCGTCGATTTGTCAATGCCC
CTCCACCCGAAAGGCCGATGACATCCGGTAACACCGTGACTACGATACGATCTGGCAAGAATGATCAGGATGATA
GGTATGAATCCCACCCCCGAGTCCGTTTATCGCCGTGGCGAAGAAACCGACTGACTCGTCTAGTCACATCAAAAC
AATTCGCAACATCGGCCGGAAGCTGACATTCCGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail