Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5605.t1
Gene name
Locationscaffold_13:549442..550973
Strand-
Gene length (bp)1531
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta 5.0E-152 25 443

GO

GO Term Description Terminal node
GO:0018279 protein N-linked glycosylation via asparagine Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0070085 glycosylation No
GO:0019538 protein metabolic process No
GO:0018196 peptidyl-asparagine modification No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0031090 organelle membrane No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006486 protein glycosylation No
GO:0006487 protein N-linked glycosylation No
GO:0018193 peptidyl-amino acid modification No
GO:1901564 organonitrogen compound metabolic process No
GO:0016020 membrane No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 420 442 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5605.t1
MRWCLALLICCFLAAVNALSSSGSRLLAILEDTEQKDLYSTLWADLEARGYDVSIESSKSEQLALFKLGERAYDH
LLIFPPKSKGLGPSLTPKHIVDFMNKDGNILLALSGKSATSSAISSLLLELDIHLSNDRSQVVVDHFNYDTLSAA
EKHDVLVLQRPGPLRSDVKAFFDGEGVLALPRVAPQTLGDSALLSPILKAPATAYSYNPKEGTPAPEDILATGSQ
LNIISAMQARNSARFTVLGSVESLEDKWFSASVKTPSGKKTPTVNREFAKQLTAWAFKETGVLKVDKVEHRLITE
GAELNPSIYRIKNETIYSIEISEYVYDKWVPFELPGDDALQLEFTMLSPFHRLNLEPVERTDSSTVFSTQFVTPD
QHGIFSFRVNYKRPFLTAIEEKLEVTNRHFAHDEYPRSWAITGGWVWIAGLWSVIGGFLAFVVVWLYSAPVADKL
KKTQ*
Coding >Pro_DTO377G3_2|g5605.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGCACGAGGA
TACGATGTCTCAATCGAATCTTCCAAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCAC
CTTCTAATCTTCCCTCCCAAGTCAAAAGGCCTCGGCCCCTCCTTGACCCCCAAACACATCGTCGACTTTATGAAC
AAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACCTCCAGCGCCATCAGCTCCCTTCTCCTCGAA
CTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGACCACTTCAACTATGACACCCTCTCGGCCGCT
GAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGTTCTGACGTCAAGGCCTTCTTTGATGGTGAG
GGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGACAGCGCCCTGCTCTCTCCGATTCTCAAGGCC
CCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCGCCGGAGGATATCCTGGCTACCGGGTCGCAG
CTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTCACTGTTCTCGGATCAGTGGAGTCGCTGGAG
GACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAGACACCTACCGTGAACCGCGAGTTCGCCAAG
CAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTTGACAAGGTCGAGCATCGCCTTATCACTGAG
GGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACTATCTACAGCATTGAGATTTCCGAGTATGTC
TACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCACCATGCTCTCGCCCTTC
CACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCAGTTCGTGACTCCCGAT
CAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGAGGAGAAGCTTGAGGTT
ACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTGGGTATGGATTGCCGGT
CTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCCTGTGGCCGATAAGCTC
AAGAAGACTCAGTAG
Transcript >Pro_DTO377G3_2|g5605.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGCACGAGGA
TACGATGTCTCAATCGAATCTTCCAAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCAC
CTTCTAATCTTCCCTCCCAAGTCAAAAGGCCTCGGCCCCTCCTTGACCCCCAAACACATCGTCGACTTTATGAAC
AAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACCTCCAGCGCCATCAGCTCCCTTCTCCTCGAA
CTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGACCACTTCAACTATGACACCCTCTCGGCCGCT
GAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGTTCTGACGTCAAGGCCTTCTTTGATGGTGAG
GGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGACAGCGCCCTGCTCTCTCCGATTCTCAAGGCC
CCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCGCCGGAGGATATCCTGGCTACCGGGTCGCAG
CTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTCACTGTTCTCGGATCAGTGGAGTCGCTGGAG
GACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAGACACCTACCGTGAACCGCGAGTTCGCCAAG
CAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTTGACAAGGTCGAGCATCGCCTTATCACTGAG
GGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACTATCTACAGCATTGAGATTTCCGAGTATGTC
TACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCACCATGCTCTCGCCCTTC
CACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCAGTTCGTGACTCCCGAT
CAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGAGGAGAAGCTTGAGGTT
ACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTGGGTATGGATTGCCGGT
CTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCCTGTGGCCGATAAGCTC
AAGAAGACTCAGTAG
Gene >Pro_DTO377G3_2|g5605.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGGTAATTAA
TCTGACTCAATTTATTGATCCTTTGCTAACTCTCGGACTCCAGCACGAGGATACGATGTCTCAATCGAATCTTCC
AAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCACCTTCTAATCTTCCCTCCCAAGTCA
AAAGGTGCGCAAACCCGACTATTGATTCGATGTCTAGTCAATTGACCTAAGAATACAGGCCTCGGCCCCTCCTTG
ACCCCCAAACACATCGTCGACTTTATGAACAAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACC
TCCAGCGCCATCAGCTCCCTTCTCCTCGAACTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGAC
CACTTCAACTATGACACCCTCTCGGCCGCTGAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGT
TCTGACGTCAAGGCCTTCTTTGATGGTGAGGGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGAC
AGCGCCCTGCTCTCTCCGATTCTCAAGGCCCCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCG
CCGGAGGATATCCTGGCTACCGGGTCGCAGCTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTC
ACTGTTCTCGGATCAGTGGAGTCGCTGGAGGACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAG
ACACCTACCGTGAACCGCGAGTTCGCCAAGCAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTT
GACAAGGTCGAGCATCGCCTTATCACTGAGGGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACT
GTACGTGAAACAATATATTGTCATTCTCTTCCAAGCTAACATGAGCCTTATTTGCCTGCAGATCTACAGCATTGA
GATTTCCGAGTATGTCTACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCAC
CATGCTCTCGCCCTTCCACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCA
GTTCGTGACTCCCGATCAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGA
GGAGAAGCTTGAGGTTACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTG
GGTATGGATTGCCGGTCTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCC
TGTGGCCGATAAGCTCAAGAAGACTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail